OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

IFT20 (NM_174887) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC201337
IFT20 (Myc-DDK-tagged)-Human intraflagellar transport 20 homolog (Chlamydomonas) (IFT20)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $150.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "IFT20 or NM_174887"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol IFT20
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC201337 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCAAGGACATCCTGGGTGAAGCAGGGCTACACTTTGATGAACTGAACAAGCTGAGGGTGTTGGACC
CAGAGGTTACCCAGCAGACCATAGAGCTGAAGGAAGAGTGCAAAGACTTTGTGGACAAAATTGGCCAGTT
TCAGAAAATAGTTGGTGGTTTAATTGAGCTTGTTGATCAACTTGCAAAAGAAGCAGAAAATGAAAAGATG
AAGAGTCTTGCTGTGTCACCCAGGCTGGAGTGCACTGGTGCAATCTCGGCTCACTGCAAGCTCTGCCTCT
CAGATTCAAGCGATTCTCCCACCTCACCCTCCCGAGTAGGTGGGACTACAGGCCATCGGTGCTCGGAACT
TGCTCAAATCTATAGCAAAGCAGAGAGAAGCTCAACAGCAGCAACTTCAAGCCCTAATAGCAGAAAAGAA
AATGCAGCTAGAAAGGTATCGGGT

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC201337 protein sequence
Red=Cloning site Green=Tags(s)

MAKDILGEAGLHFDELNKLRVLDPEVTQQTIELKEECKDFVDKIGQFQKIVGGLIELVDQLAKEAENEKM
KSLAVSPRLECTGAISAHCKLCLSDSSDSPTSPSRVGGTTGHRCSELAQIYSKAERSSTAATSSPNSRKE
NAARKVSG

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_174887
ORF Size 444 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_174887.4
RefSeq Size 1006 bp
RefSeq ORF 447 bp
Locus ID 90410
UniProt ID Q8IY31
Cytogenetics 17q11.2
MW 16 kDa
Summary This gene encodes a intraflagellar transport protein important for intracellular transport. The encoded protein forms part of a complex involved in trafficking of proteins from the Golgi body, including recycling of immune signalling components (Finetti et al., PubMed: 19855387). This gene is part of a complex set of sense-antisense loci that may be co-regulated. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. A pseudogene of this gene is located on the long arm of chromosome 14.provided by RefSeq, Jun 2012
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_174887" in other vectors (6)
SKU Description Size Price
RC201337L1 Lenti ORF clone of Human intraflagellar transport 20 homolog (Chlamydomonas) (IFT20), Myc-DDK-tagged 10 ug
$450.00
RC201337L2 Lenti ORF clone of Human intraflagellar transport 20 homolog (Chlamydomonas) (IFT20), mGFP tagged 10 ug
$450.00
RC201337L3 Lenti ORF clone of Human intraflagellar transport 20 homolog (Chlamydomonas) (IFT20), Myc-DDK-tagged 10 ug
$450.00
RC201337L4 Lenti ORF clone of Human intraflagellar transport 20 homolog (Chlamydomonas) (IFT20), mGFP tagged 10 ug
$450.00
RG201337 IFT20 (tGFP-tagged) - Human intraflagellar transport 20 homolog (Chlamydomonas) (IFT20) 10 ug
$489.00
SC319073 IFT20 (untagged)-Human intraflagellar transport 20 homolog (Chlamydomonas) (IFT20) 10 ug
$150.00

Plasmid Map for RC201337

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC201337
Circular map for RC201337

file-alt Citations

Hypomorphism for RPGRIP1L, a Ciliary Gene Vicinal to the FTO Locus, Causes Increased Adiposity in Mice
Stratigopoulos, Martin Carli, O'Day et al
Cell Metab. (2014) 19 (5), 767-79 DOI: 10.1016/j.cmet.2014.04.009
Cited by 155
AI Summary: OriGene products contributed to this study by providing the full-length murine Rpgrip1l cDNA fused to GFP (MG218118) and Myc-tagged Ift46 (MR204208) and IFT20 (RC201337) cDNAs, which were used for overexpression experiments to investigate the role of ciliary genes in adiposity and leptin signaling.
Snippet: The full-length murine Rpgrip1l cDNA (fused to GFP) under the CMV promoter was purchased from Origene (catalog number MG218118;Rockville, MD). The overexpression Myc-tagged Ift46 and IFT20 cDNA were also purchased from Origene (catalog number MR204208, RC201337). …
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products