OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DLST (NM_001933) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC201220
DLST (Myc-DDK-tagged)-Human dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex) (DLST), transcript variant 1
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $457.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA307907 Rabbit Polyclonal antibody to DLST (dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex))
100 ul
$665.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "DLST or NM_001933"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol DLST
Synonyms DLTS; KGD2; PGL7
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC201220 representing NM_001933
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTGTCCCGATCCCGCTGTGTGTCTCGGGCGTTCAGCCGCTCGCTCTCCGCCTTCCAGAAGGGGAACT
GCCCTCTAGGGAGACGTTCCCTGCCTGGGGTCTCCTTATGCCAGGGACCAGGTTACCCTAACAGCAGGAA
GGTTGTCATTAACAACAGTGTCTTCAGTGTTCGCTTTTTCAGAACTACAGCTGTATGCAAGGATGACTTG
GTTACAGTCAAAACCCCAGCGTTTGCAGAATCTGTCACAGAGGGAGATGTCAGGTGGGAGAAAGCTGTTG
GAGACACAGTTGCAGAAGATGAAGTGGTTTGTGAGATTGAAACTGACAAGACATCTGTGCAGGTTCCATC
ACCAGCAAATGGCGTGATTGAAGCTCTTTTGGTACCTGATGGGGGAAAAGTCGAAGGAGGCACTCCACTT
TTCACACTCAGGAAAACTGGTGCTGCTCCTGCTAAGGCCAAGCCGGCTGAAGCTCCTGCTGCTGCAGCCC
CAAAAGCAGAACCTACAGCAGCGGCAGTTCCTCCCCCTGCAGCACCCATACCCACTCAGATGCCACCGGT
GCCCTCGCCCTCACAACCTCCTTCTGGCAAACCTGTGTCTGCAGTAAAACCCACTGTTGCCCCACCACTA
GCTGAGCCAGGAGCTGGCAAAGGTCTGCGTTCAGAACATCGGGAGAAAATGAACAGGATGCGGCAGCGCA
TTGCTCAGCGTCTGAAGGAGGCCCAGAATACATGTGCAATGCTGACAACTTTTAATGAGATTGACATGAG
TAACATCCAGGAGATGAGGGCTCGGCACAAAGAGGCTTTTTTGAAGAAACATAACCTCAAACTAGGCTTC
ATGTCGGCATTTGTGAAGGCCTCAGCCTTTGCCTTGCAGGAACAGCCTGTTGTAAATGCAGTGATTGACG
ACACAACCAAAGAGGTGGTGTATAGGGATTATATTGACATCAGTGTTGCAGTGGCCACCCCACGGGGTCT
GGTGGTTCCAGTCATCAGGAATGTGGAAGCTATGAATTTTGCAGATATTGAACGGACCATCACTGAACTG
GGAGAGAAGGCCCGAAAGAATGAACTTGCCATTGAAGATATGGATGGCGGTACCTTCACCATTAGCAATG
GAGGCGTTTTTGGCTCGCTCTTTGGAACACCCATTATCAACCCCCCTCAGTCTGCCATCCTGGGGATGCA
TGGCATCTTTGACAGGCCAGTGGCTATAGGAGGCAAGGTAGAGGTGCGGCCCATGATGTACGTGGCACTG
ACCTATGATCACCGGCTGATTGATGGCAGAGAGGCTGTGACTTTCCTCCGCAAAATCAAGGCAGCGGTAG
AGGATCCCAGAGTCCTCCTCCTGGATCTT

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC201220 representing NM_001933
Red=Cloning site Green=Tags(s)

MLSRSRCVSRAFSRSLSAFQKGNCPLGRRSLPGVSLCQGPGYPNSRKVVINNSVFSVRFFRTTAVCKDDL
VTVKTPAFAESVTEGDVRWEKAVGDTVAEDEVVCEIETDKTSVQVPSPANGVIEALLVPDGGKVEGGTPL
FTLRKTGAAPAKAKPAEAPAAAAPKAEPTAAAVPPPAAPIPTQMPPVPSPSQPPSGKPVSAVKPTVAPPL
AEPGAGKGLRSEHREKMNRMRQRIAQRLKEAQNTCAMLTTFNEIDMSNIQEMRARHKEAFLKKHNLKLGF
MSAFVKASAFALQEQPVVNAVIDDTTKEVVYRDYIDISVAVATPRGLVVPVIRNVEAMNFADIERTITEL
GEKARKNELAIEDMDGGTFTISNGGVFGSLFGTPIINPPQSAILGMHGIFDRPVAIGGKVEVRPMMYVAL
TYDHRLIDGREAVTFLRKIKAAVEDPRVLLLDL

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_001933
ORF Size 1359 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001933.2
RefSeq Size 2828 bp
RefSeq ORF 1362 bp
Locus ID 1743
UniProt ID P36957
Cytogenetics 14q24.3
Domains 2-oxoacid_dh, biotin_lipoyl
Protein Pathways Citrate cycle (TCA cycle), Lysine degradation, Metabolic pathways
MW 48.6 kDa
Summary This gene encodes a mitochondrial protein that belongs to the 2-oxoacid dehydrogenase family. This protein is one of the three components (the E2 component) of the 2-oxoglutarate dehydrogenase complex that catalyzes the overall conversion of 2-oxoglutarate to succinyl-CoA and CO(2). Alternatively spliced transcript variants have been found for this gene. provided by RefSeq, Oct 2011
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_001933" in other vectors (6)
SKU Description Size Price
RC201220L1 Lenti ORF clone of Human dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex) (DLST), transcript variant 1, Myc-DDK-tagged 10 ug
$757.00
RC201220L2 Lenti ORF clone of Human dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex) (DLST), transcript variant 1, mGFP tagged 10 ug
$757.00
RC201220L3 Lenti ORF clone of Human dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex) (DLST), transcript variant 1, Myc-DDK-tagged 10 ug
$757.00
RC201220L4 Lenti ORF clone of Human dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex) (DLST), transcript variant 1, mGFP tagged 10 ug
$757.00
RG201220 DLST (tGFP-tagged) - Human dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex) (DLST), transcript variant 1 10 ug
$657.00
SC118954 DLST (untagged)-Human dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex) (DLST), transcript variant 1 10 ug
$457.00

Plasmid Map for RC201220

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC201220
Circular map for RC201220

file-alt Citations

Mitochondrial NADPH fuels mitochondrial fatty acid synthesis and lipoylation to power oxidative metabolism
Kim, Kesavan, Ryu et al
Nat Cell Biol (2025)
Cited by 36
AI Summary: OriGene products, including cDNA clones for NADK2 (RC214147), NADK (RC200544), DLAT (RC206640), DLST (RC201220), DBT (RC201998), GCSH (RC217886), and ACP (RC208941), were used to generate expression constructs essential for investigating the roles of mitochondrial enzymes in NADPH-dependent fatty acid synthesis and protein lipoylation in this study.
Snippet: ADK2 cDNA (OriGene, RC214147), NADK2 (D161A), NADK (OriGene, RC200544) and MTS-NADK were subcloned into Lenti-III-PGK lentivirus vector (Applied Biological Materials, G305) with a C-terminal FLAG-tag. DLAT (OriGene, RC206640), DLST (OriGene, RC201220), DBT (OriGene, RC201998) and GCSH (OriGene, RC217886) cDNAs were subcloned into a pcDNA 5/FRT/TO plasmid (Thermo Fisher Scientific, V652020) with a C-terminal HA-tag. … ACP cDNA (OriGene, RC208941) was subcloned into a pcDNA 5/FRT/TO with a C-terminal FLAG-tag. …
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products