OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

NCF4 (NM_013416) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC201191
NCF4 (Myc-DDK-tagged)-Human neutrophil cytosolic factor 4, 40kDa (NCF4), transcript variant 2
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $457.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA809135 NCF4 mouse monoclonal antibody, clone OTI4B5 (formerly 4B5) 100 ul
$447.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "NCF4 or NM_013416"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol NCF4
Synonyms CGD3; NCF; P40PHOX; SH3PXD4
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC201191 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTGTGGCCCAGCAGCTGCGGGCCGAGAGTGACTTTGAACAGCTTCCGGATGATGTTGCCATCTCGG
CCAACATTGCTGACATCGAGGAGAAGAGAGGCTTCACCAGCCACTTTGTTTTCGTCATCGAGGTGAAGAC
AAAAGGAGGATCCAAGTACCTCATCTACCGCCGCTACCGCCAGTTCCATGCTTTGCAGAGCAAGCTGGAG
GAGCGCTTCGGGCCAGACAGCAAGAGCAGTGCCCTGGCCTGTACCCTGCCCACACTCCCAGCCAAAGTCT
ACGTGGGTGTGAAACAGGAGATCGCCGAGATGCGGATACCTGCCCTCAACGCCTACATGAAGAGCCTGCT
CAGCCTGCCGGTCTGGGTGCTGATGGATGAGGACGTCCGGATCTTCTTTTACCAGTCGCCCTATGACTCA
GAGCAGGTGCCCCAGGCACTCCGCCGGCTCCGCCCGCGCACCCGGAAAGTCAAGAGCGTGTCCCCACAGG
GCAACAGCGTTGACCGCATGGCAGCTCCGAGAGCAGAGGCTCTATTTGACTTCACTGGAAACAGCAAACT
GGAGCTGAATTTCAAAGCTGGAGATGTGATCTTCCTCCTCAGTCGGATCAACAAAGACTGGCTGGAGGGC
ACTGTCCGGGGAGCCACGGGCATCTTCCCTCTCTCCTTCGTGAAGATCCTCAAAGACTTCCCTGAGGAGG
ACGACCCCACCAACTGGCTGCGTTGCTACTACTACGAAGACACCATCAGCACCATCAAGTCTGTGGCCTG
GGAGGGAGGGGCCTGTCCAGCCTTCCTGCCATCCCTACGACCACCGCCCCTCACATCACCTTCTCATGGG
TCCCTCTCCCACTCCAAAGCCCCCAGTGGCTCCCAGATGAGCCACAATGCTGTAACAAGCCATCAACGTC
CAGGGTGGCCTGGCCAGCCTCATTCCCCTTTCCCCCACCCCACACCCCACTTCCAGCCTGATGCCTCCTT
ACTCCAGCCTGTCACCCCCTTAGGGACATCGCGGTGGAGGAAGATCTCAGCAGCACTCCCCTAT

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC201191 protein sequence
Red=Cloning site Green=Tags(s)

MAVAQQLRAESDFEQLPDDVAISANIADIEEKRGFTSHFVFVIEVKTKGGSKYLIYRRYRQFHALQSKLE
ERFGPDSKSSALACTLPTLPAKVYVGVKQEIAEMRIPALNAYMKSLLSLPVWVLMDEDVRIFFYQSPYDS
EQVPQALRRLRPRTRKVKSVSPQGNSVDRMAAPRAEALFDFTGNSKLELNFKAGDVIFLLSRINKDWLEG
TVRGATGIFPLSFVKILKDFPEEDDPTNWLRCYYYEDTISTIKSVAWEGGACPAFLPSLRPPPLTSPSHG
SLSHSKAPSGSQMSHNAVTSHQRPGWPGQPHSPFPHPTPHFQPDASLLQPVTPLGTSRWRKISAALPY

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_013416
ORF Size 1044 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_013416.2, NP_038202.1
RefSeq Size 1646 bp
RefSeq ORF 1047 bp
Locus ID 4689
UniProt ID Q15080
Cytogenetics 22q12.3
Domains PX, SH3
Protein Pathways Leukocyte transendothelial migration
MW 39 kDa
Summary The protein encoded by this gene is a cytosolic regulatory component of the superoxide-producing phagocyte NADPH-oxidase, a multicomponent enzyme system important for host defense. This protein is preferentially expressed in cells of myeloid lineage. It interacts primarily with neutrophil cytosolic factor 2 (NCF2/p67-phox) to form a complex with neutrophil cytosolic factor 1 (NCF1/p47-phox), which further interacts with the small G protein RAC1 and translocates to the membrane upon cell stimulation. This complex then activates flavocytochrome b, the membrane-integrated catalytic core of the enzyme system. The PX domain of this protein can bind phospholipid products of the PI(3) kinase, which suggests its role in PI(3) kinase-mediated signaling events. The phosphorylation of this protein was found to negatively regulate the enzyme activity. Alternatively spliced transcript variants encoding distinct isoforms have been observed. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_013416" in other vectors (6)
SKU Description Size Price
RC201191L1 Lenti ORF clone of Human neutrophil cytosolic factor 4, 40kDa (NCF4), transcript variant 2, Myc-DDK-tagged 10 ug
$757.00
RC201191L2 Lenti ORF clone of Human neutrophil cytosolic factor 4, 40kDa (NCF4), transcript variant 2, mGFP tagged 10 ug
$757.00
RC201191L3 Lenti ORF clone of Human neutrophil cytosolic factor 4, 40kDa (NCF4), transcript variant 2, Myc-DDK-tagged 10 ug
$757.00
RC201191L4 Lenti ORF clone of Human neutrophil cytosolic factor 4, 40kDa (NCF4), transcript variant 2, mGFP tagged 10 ug
$757.00
RG201191 NCF4 (tGFP-tagged) - Human neutrophil cytosolic factor 4, 40kDa (NCF4), transcript variant 2 10 ug
$657.00
SC115259 NCF4 (untagged)-Human neutrophil cytosolic factor 4, 40kDa (NCF4), transcript variant 2 10 ug
$457.00

Plasmid Map for RC201191

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC201191
Circular map for RC201191

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products