OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

NTAQ1 (NM_018024) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC201055
WDYHV1 (Myc-DDK-tagged)-Human WDYHV motif containing 1 (WDYHV1)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA330828 Rabbit Polyclonal Anti-WDYHV1 Antibody
100 ul
$585.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "NTAQ1 or NM_018024"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol NTAQ1
Synonyms C8orf32; WDYHV1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC201055 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAAGGTAATGGCCCCGCTGCTGTCCACTACCAGCCGGCCAGCCCCCCGCGGGACGCCTGCGTCTACA
GCAGCTGCTACTGTGAAGAAAATGTTTGGAAGCTCTGTGAATACATCAAAAACCATGACCAGTATCCTTT
AGAAGAATGTTATGCTGTCTTCATATCTAATGAGAGGAAGATGATACCTATCTGGAAACAACAGGCGAGA
CCTGGAGATGGACCTGTGATCTGGGATTACCATGTTGTTTTGCTTCATGTTTCAAGTGGAGGACAGAGCT
TCATTTATGATCTCGATACTGTCTTGCCATTTCCCTGCCTCTTTGACACTTATGTAGAAGATGCCATTAA
GTCTGATGATGACATTCACCCACAGTTTAGGAGGAAATTTAGAGTGATCTGTGCAGATTCATATTTGAAG
AACTTTGCTTCTGACCGATCTCACATGAAAGACTCCAGTGGGAATTGGAGAGAGCCTCCGCCGCCATATC
CCTGCATTGAGACTGGAGATTCCAAAATGAACCTGAACGATTTCATCAGTATGGATCCCAAGGTAGGATG
GGGCGCCGTCTACACACTATCCGAATTTACACATCGGTTTGGCAGTAAAAACTGC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC201055 protein sequence
Red=Cloning site Green=Tags(s)

MEGNGPAAVHYQPASPPRDACVYSSCYCEENVWKLCEYIKNHDQYPLEECYAVFISNERKMIPIWKQQAR
PGDGPVIWDYHVVLLHVSSGGQSFIYDLDTVLPFPCLFDTYVEDAIKSDDDIHPQFRRKFRVICADSYLK
NFASDRSHMKDSSGNWREPPPPYPCIETGDSKMNLNDFISMDPKVGWGAVYTLSEFTHRFGSKNC

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_018024
ORF Size 615 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_018024.3
RefSeq Size 1568 bp
RefSeq ORF 618 bp
Locus ID 55093
UniProt ID Q96HA8
Cytogenetics 8q24.13
Protein Families Stem cell - Pluripotency
MW 23.6 kDa
Summary Mediates the side-chain deamidation of N-terminal glutamine residues to glutamate, an important step in N-end rule pathway of protein degradation. Conversion of the resulting N-terminal glutamine to glutamate renders the protein susceptible to arginylation, polyubiquitination and degradation as specified by the N-end rule. Does not act on substrates with internal or C-terminal glutamine and does not act on non-glutamine residues in any position. Does not deaminate acetylated N-terminal glutamine. With the exception of proline, all tested second-position residues on substrate peptides do not greatly influence the activity. In contrast, a proline at position 2, virtually abolishes deamidation of N-terminal glutamine.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_018024" in other vectors (6)
SKU Description Size Price
RC201055L1 Lenti ORF clone of Human WDYHV motif containing 1 (WDYHV1), Myc-DDK-tagged 10 ug
$600.00
RC201055L2 Lenti ORF clone of Human WDYHV motif containing 1 (WDYHV1), mGFP tagged 10 ug
$600.00
RC201055L3 Lenti ORF clone of Human WDYHV motif containing 1 (WDYHV1), Myc-DDK-tagged 10 ug
$600.00
RC201055L4 Lenti ORF clone of Human WDYHV motif containing 1 (WDYHV1), mGFP tagged 10 ug
$600.00
RG201055 WDYHV1 (tGFP-tagged) - Human WDYHV motif containing 1 (WDYHV1) 10 ug
$489.00 $500.00
SC113806 WDYHV1 (untagged)-Human WDYHV motif containing 1 (WDYHV1) 10 ug
$300.00

Plasmid Map for RC201055

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC201055
Circular map for RC201055

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products