OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

NNMT (NM_006169) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC200641
NNMT (Myc-DDK-tagged)-Human nicotinamide N-methyltransferase (NNMT)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA502624 NNMT mouse monoclonal antibody, clone OTI3D8 (formerly 3D8) 100 ul
$447.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "NNMT or NM_006169"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol NNMT
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC200641 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAATCAGGCTTCACCTCCAAGGACACCTATCTAAGCCATTTTAACCCTCGGGATTACCTAGAAAAAT
ATTACAAGTTTGGTTCTAGGCACTCTGCAGAAAGCCAGATTCTTAAGCACCTTCTGAAAAATCTTTTCAA
GATATTCTGCCTAGACGGTGTGAAGGGAGACCTGCTGATTGACATCGGCTCTGGCCCCACTATCTATCAG
CTCCTCTCTGCTTGTGAATCCTTTAAGGAGATCGTCGTCACTGACTACTCAGACCAGAACCTGCAGGAGC
TGGAGAAGTGGCTGAAGAAAGAGCCAGAGGCCTTTGACTGGTCCCCAGTGGTGACCTATGTGTGTGATCT
TGAAGGGAACAGAGTCAAGGGTCCAGAGAAGGAGGAGAAGTTGAGACAGGCGGTCAAGCAGGTGCTGAAG
TGTGATGTGACTCAGAGCCAGCCACTGGGGGCCGTCCCCTTACCCCCGGCTGACTGCGTGCTCAGCACAC
TGTGTCTGGATGCCGCCTGCCCAGACCTCCCCACCTACTGCAGGGCGCTCAGGAACCTCGGCAGCCTACT
GAAGCCAGGGGGCTTCCTGGTGATCATGGATGCGCTCAAGAGCAGCTACTACATGATTGGTGAGCAGAAG
TTCTCCAGCCTCCCCCTGGGCCGGGAGGCAGTAGAGGCTGCTGTGAAAGAGGCTGGCTACACAATCGAAT
GGTTTGAGGTGATCTCGCAAAGTTATTCTTCCACCATGGCCAACAACGAAGGACTTTTCTCCCTGGTGGC
GAGGAAGCTGAGCAGACCCCTG

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC200641 protein sequence
Red=Cloning site Green=Tags(s)

MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFCLDGVKGDLLIDIGSGPTIYQ
LLSACESFKEIVVTDYSDQNLQELEKWLKKEPEAFDWSPVVTYVCDLEGNRVKGPEKEEKLRQAVKQVLK
CDVTQSQPLGAVPLPPADCVLSTLCLDAACPDLPTYCRALRNLGSLLKPGGFLVIMDALKSSYYMIGEQK
FSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSSTMANNEGLFSLVARKLSRPL

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_006169
ORF Size 792 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_006169.3
RefSeq Size 1579 bp
RefSeq ORF 795 bp
Locus ID 4837
UniProt ID P40261
Cytogenetics 11q23.2
Domains NNMT_PNMT_TEMT
Protein Pathways Metabolic pathways, Nicotinate and nicotinamide metabolism
MW 29.6 kDa
Summary N-methylation is one method by which drug and other xenobiotic compounds are metabolized by the liver. This gene encodes the protein responsible for this enzymatic activity which uses S-adenosyl methionine as the methyl donor. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_006169" in other vectors (6)
SKU Description Size Price
RC200641L1 Lenti ORF clone of Human nicotinamide N-methyltransferase (NNMT), Myc-DDK-tagged 10 ug
$600.00
RC200641L2 Lenti ORF clone of Human nicotinamide N-methyltransferase (NNMT), mGFP tagged 10 ug
$600.00
RC200641L3 Lenti ORF clone of Human nicotinamide N-methyltransferase (NNMT), Myc-DDK-tagged 10 ug
$600.00
RC200641L4 Lenti ORF clone of Human nicotinamide N-methyltransferase (NNMT), mGFP tagged 10 ug
$600.00
RG200641 NNMT (tGFP-tagged) - Human nicotinamide N-methyltransferase (NNMT) 10 ug
$489.00 $500.00
SC321591 NNMT (untagged)-Human nicotinamide N-methyltransferase (NNMT) 10 ug
$300.00

Plasmid Map for RC200641

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC200641
Circular map for RC200641

file-alt Citations

Nicotinamide N-methyltransferase enhances paclitaxel resistance in ovarian clear cell carcinoma
Kikuchi-Koike, Sakamoto, Sasajima et al
Hum Cell (2025) 38 (5), 151 DOI: 10.1007/s13577-025-01282-z
Cited by 4
Snippet: We transfected the NNMT Expression Plasmid DNA (RC200641;OriGene Technologies, Inc., MD, USA) into the ES-2 cell line that was cultured in 6-well plates using Lipofectamine 2000 Transfection Reagent (11,668,019;Thermo Fisher Scientific)
FigureFigureFigure
GPX8 regulates clear cell renal cell carcinoma tumorigenesis through promoting lipogenesis by NNMT
Nguyen, Nguyen, Kim et al
J Exp Clin Cancer Res (2023) 42 (1), 42 DOI: 10.1186/s13046-023-02607-2
Cited by 41
AI Summary: OriGene products, specifically the Vector (control, CAT#: PS100001), pCMV6-Entry-Myc-DDK-tag NNMT plasmid (CAT#: RC200641), and pCMV6-Entry-Myc-DDK-tag VHL plasmid (CAT#: RC216151), were used to manipulate gene expression in cell lines to investigate the roles of NNMT and VHL in the regulation of lipid metabolism and tumorigenesis in clear cell renal cell carcinoma.
Snippet: …The downstream regulator was identified as nicotinamide N-methyltransferase (NNMT): its knockdown phenocopied, and its expression rescued, GPX8 silencing both in vitro and in vivo. Mechanically, GPX8 regulated NNMT via IL6-STAT3 signaling, and blocking this axis suppressed ccRCC survival by activating AMPK. Notably, neither the GPX8-NNMT axis nor the DNL flux was affected by the von Hippel Lindau (VHL) status, the conventional regulator of ccRCC high lipid content.Taken together, our findings unravel the roles of the VHL-independent GPX8-NNMT axis in ccRCC lipid metabolism as related to the phenotypes and growth of ccRCC, which may be targeted for therapeutic purposes. 2023. The Author(s);- Vector (control, CAT#: PS100001) and pCMV6-Entry-Myc-DDK-tag carrying NNMT (CAT#: RC200641) and VHL (CAT#: RC216151) were obtained from Origene (US). …
FigureFigureFigure
A Proteogenomic Atlas of Clear Cell Renal Cell Carcinoma in a Chinese Population
Ding, Qu, Feng et al
Research Square (2021)
Snippet: Whole-length NNMT, MARS, KU70, KU80, and p53 cDNA clones were purchased from Origene
BRCA1 Deficiency Upregulates NNMT, Which Reprograms Metabolism and Sensitizes Ovarian Cancer Cells to Mitochondrial Metabolic Targeting Agents
Kanakkanthara, Kurmi, Ekstrom et al
Cancer Res. (2019) 79 (23), 5920-5929 DOI: 10.1158/0008-5472.CAN-19-1405
AI Summary: OriGene contributed to this study by providing a mammalian expression plasmid encoding human NNMT fused to Myc and DDK tags (Cat# RC200641), which was used to investigate the role of NNMT in metabolic reprogramming of ovarian cancer cells.
Snippet: Plasmids, plasmid transfection, and stable cell line generation A mammalian expression plasmid that encoded human NNMT fused to Myc and DDK tags at its C terminus was obtained from Origene (Cat# RC200641). For the generation of stable
NNMT silencing activates tumor suppressor PP2A, inactivates oncogenic STKs and inhibits tumor forming ability
Palanichamy, Kanji, Gordon et al
Clin. Cancer Res. (2016)
AI Summary: OriGene’s true-ORF NNMT human cDNA clone in a pCMV6-Neo vector was used to generate NNMT-overexpressing U87 cell lines, enabling the study of NNMT’s role in glioblastoma tumorigenesis in this paper.
Snippet: The U87-NNMT-OE cell line was generated using the true-ORF NNMT human cDNAclone in a pCMV6-Neo vector purchased from Origene. MTT Proliferation Assay. The MTT assaykit was used according to the manufacturer's instructions (ATCC). ... Cite SaveSaving
Showing 1-5 of 5 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products