OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

LAMTOR1 (NM_017907) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC200159
LAMTOR1 (Myc-DDK-tagged)-Human late endosomal/lysosomal adaptor, MAPK and MTOR activator 1 (LAMTOR1)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $150.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "LAMTOR1 or NM_017907"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol LAMTOR1
Synonyms C11orf59; p18; p27RF-Rho; PDRO; Ragulator1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC200159 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGGTGCTGCTACAGCAGCGAGAACGAGGACTCGGACCAGGACCGAGAGGAGCGGAAGCTGCTGCTGG
ACCCTAGCAGCCCCCCTACCAAAGCTCTCAATGGAGCCGAGCCCAACTACCACAGCCTGCCTTCCGCTCG
CACTGATGAGCAGGCCCTGCTCTCTTCCATCCTTGCCAAGACAGCCAGCAACATCATTGATGTGTCTGCT
GCAGACTCACAGGGCATGGAGCAGCATGAGTACATGGACCGTGCCAGGCAGTACAGCACCCGCTTGGCTG
TGCTGAGCAGCAGCCTGACCCATTGGAAGAAGCTGCCACCGCTGCCGTCTCTTACCAGCCAGCCCCACCA
AGTGCTGGCCAGTGAGCCCATCCCGTTCTCTGATTTGCAGCAGGTCTCCAGGATAGCTGCTTATGCCTAC
AGTGCACTTTCTCAGATCCGTGTGGACGCAAAAGAGGAGCTGGTTGTACAGTTTGGGATCCCA

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC200159 protein sequence
Red=Cloning site Green=Tags(s)

MGCCYSSENEDSDQDREERKLLLDPSSPPTKALNGAEPNYHSLPSARTDEQALLSSILAKTASNIIDVSA
ADSQGMEQHEYMDRARQYSTRLAVLSSSLTHWKKLPPLPSLTSQPHQVLASEPIPFSDLQQVSRIAAYAY
SALSQIRVDAKEELVVQFGIP

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_017907
ORF Size 483 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_017907.3
RefSeq Size 1198 bp
RefSeq ORF 486 bp
Locus ID 55004
UniProt ID Q6IAA8
Cytogenetics 11q13.4
MW 17.7 kDa
Summary As part of the Ragulator complex it is involved in amino acid sensing and activation of mTORC1, a signaling complex promoting cell growth in response to growth factors, energy levels, and amino acids. Activated by amino acids through a mechanism involving the lysosomal V-ATPase, the Ragulator functions as a guanine nucleotide exchange factor activating the small GTPases Rag. Activated Ragulator and Rag GTPases function as a scaffold recruiting mTORC1 to lysosomes where it is in turn activated. LAMTOR1 is directly responsible for anchoring the Ragulator complex to membranes. Also required for late endosomes/lysosomes biogenesis it may regulate both the recycling of receptors through endosomes and the MAPK signaling pathway through recruitment of some of its components to late endosomes. May be involved in cholesterol homeostasis regulating LDL uptake and cholesterol release from late endosomes/lysosomes. May also play a role in RHOA activation.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_017907" in other vectors (6)
SKU Description Size Price
RC200159L1 Lenti ORF clone of Human late endosomal/lysosomal adaptor, MAPK and MTOR activator 1 (LAMTOR1), Myc-DDK-tagged 10 ug
$450.00
RC200159L2 Lenti ORF clone of Human late endosomal/lysosomal adaptor, MAPK and MTOR activator 1 (LAMTOR1), mGFP tagged 10 ug
$450.00
RC200159L3 Lenti ORF clone of Human late endosomal/lysosomal adaptor, MAPK and MTOR activator 1 (LAMTOR1), Myc-DDK-tagged 10 ug
$450.00
RC200159L4 Lenti ORF clone of Human late endosomal/lysosomal adaptor, MAPK and MTOR activator 1 (LAMTOR1), mGFP tagged 10 ug
$450.00
RG200159 LAMTOR1 (tGFP-tagged) - Human late endosomal/lysosomal adaptor, MAPK and MTOR activator 1 (LAMTOR1) 10 ug
$350.00
SC126849 LAMTOR1 (untagged)-Human late endosomal/lysosomal adaptor, MAPK and MTOR activator 1 (LAMTOR1) 10 ug
$150.00

Plasmid Map for RC200159

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC200159
Circular map for RC200159

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products