OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Aifm2 (NM_153779) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MR205050
Aifm2 (Myc-DDK-tagged) - Mouse apoptosis-inducing factor, mitochondrion-associated 2 (Aifm2), nuclear gene encoding mitochondrial protein, transcript variant 1
Interest in protein/lysate? Submit request here!
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
$289.00 $457.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "Aifm2 or NM_153779"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Aifm2
Synonyms 5430437E11Rik; Amid; D730001I10Rik; PRG3
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR205050 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGGTCCCAGGTCTCGGTGGATACAGGAGCCGTGCACGTGGTGATCGTGGGCGGGGGCTTCGGAGGGA
TAGCGGCTGCCAGCCAGCTGCAGGCGCTGAATGTCCCCTTCATGCTGGTGGATATGAAGGACTCCTTCCA
CCACAATGTGGCAGCCCTCCGGGCCTCCGTGGAGAGCGGGTTCGCCAAAAAGACATTCATTTCGTACTCT
GCGACCTTCAAGGACAACTTCCGCCAGGGCAAAGTGATTGGCATAGACTTGAAGAACCGGATGGTGTTGC
TACAGGGTGGCGAGGCCTTGCCCTTCTCACATCTTATCCTGGCCACAGGCAGCACCGGACCCTTCCCTGG
CAAGTTTAACGAGGTGTCCTGCCAGCAGGCAGCCATCCAGGCCTATGAGGACATGGTGAAGCAGATCCAG
CGCTCACAATTCATCGTGGTGGTGGGAGGCGGCTCTGCAGGAGTAGAGATGGCAGCAGAGATTAAAACCG
AGTACCCTGAGAAGGAGGTCACTCTTATCCACTCCAGAGTACCCCTGGCCGACAAGGAACTCCTGCCCTG
TGTGCGGCAGGAAGTGAAGGAGATCCTCCTCCGGAAGGGTGTGCAGCTGCTGCTGAGTGAGCGGGTGAGC
AACCTGGAGGAACTGCCTCGCAATGAGTATCGGGAGTACATCAAGGTGGAGACAGACAAGGGCACGGAGG
TGGCCACCAACATGGTGATTGTGTGCAATGGGATCAAGATCAACAGCTCTGCCTACCGCAGTGCATTTGA
GAGTAGGCTGGCTAGCAATGGTGCTCTGAAAGTGAACGAGTTCCTCCAGGTGGAAGGTTACAGCAATATT
TATGCCATTGGTGACTGTGCCGATACCAAGGAGCCCAAGATGGCCTACCACGCTGGCCTGCATGCCAATG
TTGCCGTGGCCAACATCGTCAACTCCATGAAGCAGAGGCCACTCAAAGCTTACAAGCCAGAGACTGACCA
ACCACCGGCAGCTTTGTCCCCGGCTCTGCTGCTG

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>MR205050 protein sequence
Red=Cloning site Green=Tags(s)

MGSQVSVDTGAVHVVIVGGGFGGIAAASQLQALNVPFMLVDMKDSFHHNVAALRASVESGFAKKTFISYS
ATFKDNFRQGKVIGIDLKNRMVLLQGGEALPFSHLILATGSTGPFPGKFNEVSCQQAAIQAYEDMVKQIQ
RSQFIVVVGGGSAGVEMAAEIKTEYPEKEVTLIHSRVPLADKELLPCVRQEVKEILLRKGVQLLLSERVS
NLEELPRNEYREYIKVETDKGTEVATNMVIVCNGIKINSSAYRSAFESRLASNGALKVNEFLQVEGYSNI
YAIGDCADTKEPKMAYHAGLHANVAVANIVNSMKQRPLKAYKPETDQPPAALSPALLL

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_153779
ORF Size 1014 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_153779.1
RefSeq Size 1351 bp
RefSeq ORF 1143 bp
Locus ID 71361
UniProt ID Q8BUE4
Cytogenetics 10 B4
MW 36.7 kDa
Summary Oxidoreductase, which may play a role in mediating a p53/TP53-dependent apoptosis response. Probable oxidoreductase that acts as a caspase-independent mitochondrial effector of apoptotic cell death (By similarity). May contribute to genotoxin-induced growth arrest.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_153779" in other vectors (3)
SKU Description Size Price
MC207705 Aifm2 (untagged) - Mouse apoptosis-inducing factor, mitochondrion-associated 2 (Aifm2), nuclear gene encoding mitochondrial protein, transcript variant 1, (10ug) 10 ug
$503.00
MR205050L3 Lenti ORF clone of Aifm2 (Myc-DDK-tagged) - Mouse apoptosis-inducing factor, mitochondrion-associated 2 (Aifm2), nuclear gene encoding mitochondrial protein, transcript variant 1 10 ug
$757.00
MR205050L4 Lenti ORF clone of Aifm2 (mGFP-tagged) - Mouse apoptosis-inducing factor, mitochondrion-associated 2 (Aifm2), nuclear gene encoding mitochondrial protein, transcript variant 1 10 ug
$757.00

Plasmid Map for MR205050

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for MR205050
Circular map for MR205050

file-alt Citations

The origin of hepatocellular carcinoma depends on metabolic zonation
Guo, Liang, Chung et al
Science (2025)
Cited by 36
AI Summary: In this study, the authors used Fsp1 cDNA from OriGene (#MR205050) to investigate the metabolic determinants of hepatocellular carcinoma initiation in different liver zones.
Snippet: ctor px333 (Addgene #64073). cDNA for GFP and Luciferase were synthesized by GENEWIZ, and cDNA for Gstm3 were synthesized from Genscript. Fsp1 cDNA was purchased from Origene (#MR205050). Gateway sites were added to the cDNA through PCR, and genes of interest wer
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products