OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Tor1a (NM_144884) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MR204930
Tor1a (Myc-DDK-tagged) - Mouse torsin family 1, member A (torsin A) (Tor1a)
Interest in protein/lysate? Submit request here!
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
$289.00 $457.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "Tor1a or NM_144884"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Tor1a
Synonyms DQ2; Dyt1; torsinA
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR204930 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAGCTTGGCCGGGCCGCTCTGGCCCTGCTGCTGCTGGCGCCGTGCGTGGTTCGTGCGGTGGAGCCCA
TCAGCCTGAGTCTGGCCCTGGCCGGCGTACTCACCACCTATATCTCCTACCCTCGTCTCTACTGCCTCTT
CGCCGAGTGCTGCGGCCAGATGCGGAGCCTCAGCCGGGAGGCGCTGCAGAAAGATCTGGATAACAAGCTC
TTTGGACAGCATCTTGCAAAAAAAGTCATCCTAAACGCCGTGTCTGGTTTCCTAAGCAACCCGAAGCCCA
AGAAGCCCCTTACCCTCTCTCTGCACGGGTGGACGGGCACCGGCAAAAACTTCGCCAGCAAGATCATCGC
GGAGAATATTTACGAGGGCGGACTGAACAGTGACTATGTACACCTGTTTGTGGCCACGCTACACTTCCCC
CACGCCTCTAACATCACACAGTATAAGGACCAGTTACAGATGTGGATCAGAGGCAACGTGAGCGCCTGTG
CTCGCTCCATCTTCATCTTTGATGAGATGGACAAGATGCATGCCGGCCTCATCGACGCCATCAAGCCTTT
CCTAGACTATTACGATGTGGTAGATGAGGTCTCCTATCAGAAAGCCATCTTCATCTTCCTCAGCAATGCA
GGGGCAGAGAGGATCACAGACGTGGCTCTGGATTTCTGGAAAAGTGGGAAGCAGAGGGAAGAAATCAAGC
TCAGAGACATGGAGCCCGCCCTGGCCGTGTCGGTCTTCAATAACAAGAACAGTGGCTTCTGGCACAGCAG
CCTCATTGACCGGAACCTCATAGATTATTTTGTCCCCTTCCTGCCCCTGGAGTACAAGCACCTGAAAATG
TGCATCAGAGTGGAGATGCAGTCCCGAGGCTATGAAGTAGATGAGGACATCATCAGCAAGGTAGCGGAAG
AGATGACGTTCTTCCCCAAGGAGGAGAAGGTCTTCTCTGACAAGGGCTGCAAGACTGTGTTCACCAAGCT
GGACTACTACCTGGATGAC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>MR204930 protein sequence
Red=Cloning site Green=Tags(s)

MKLGRAALALLLLAPCVVRAVEPISLSLALAGVLTTYISYPRLYCLFAECCGQMRSLSREALQKDLDNKL
FGQHLAKKVILNAVSGFLSNPKPKKPLTLSLHGWTGTGKNFASKIIAENIYEGGLNSDYVHLFVATLHFP
HASNITQYKDQLQMWIRGNVSACARSIFIFDEMDKMHAGLIDAIKPFLDYYDVVDEVSYQKAIFIFLSNA
GAERITDVALDFWKSGKQREEIKLRDMEPALAVSVFNNKNSGFWHSSLIDRNLIDYFVPFLPLEYKHLKM
CIRVEMQSRGYEVDEDIISKVAEEMTFFPKEEKVFSDKGCKTVFTKLDYYLDD

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_144884
ORF Size 999 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_144884.2
RefSeq Size 1452 bp
RefSeq ORF 1002 bp
Locus ID 30931
UniProt ID Q9ER39
Cytogenetics 2 B
MW 37.8 kDa
Summary Protein with chaperone functions important for the control of protein folding, processing, stability and localization as well as for the reduction of misfolded protein aggregates. Involved in the regulation of synaptic vesicle recycling, controls STON2 protein stability in collaboration with the COP9 signalosome complex (CSN). In the nucleus, may link the cytoskeleton with the nuclear envelope, this mechanism seems to be crucial for the control of nuclear polarity, cell movement and, specifically in neurons, nuclear envelope integrity. Participates in the cellular trafficking and may regulate the subcellular location of multipass membrane proteins such as the dopamine transporter SLC6A3, leading to the modulation of dopamine neurotransmission. In the endoplasmic reticulum, plays a role in the quality control of protein folding by increasing clearance of misfolded proteins such as SGCE variants or holding them in an intermediate state for proper refolding. May have a redundant function with TOR1B in non-neural tissues.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_144884" in other vectors (4)
SKU Description Size Price
MC201138 Tor1a (untagged) - Mouse torsin family 1, member A (torsin A) (Tor1a), (10ug) 10 ug
$457.00
MG204930 Tor1a (tGFP-tagged) - Mouse torsin family 1, member A (torsin A) (Tor1a) 10 ug
$657.00
MR204930L3 Lenti ORF clone of Tor1a (Myc-DDK-tagged) - Mouse torsin family 1, member A (torsin A) (Tor1a) 10 ug
$757.00
MR204930L4 Lenti ORF clone of Tor1a (mGFP-tagged) - Mouse torsin family 1, member A (torsin A) (Tor1a) 10 ug
$757.00

Plasmid Map for MR204930

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for MR204930
Circular map for MR204930

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products