OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Rprd1b (NM_027434) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MR204728
Rprd1b (Myc-DDK-tagged) - Mouse regulation of nuclear pre-mRNA domain containing 1B (Rprd1b)
Interest in protein/lysate? Submit request here!
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
$289.00 $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "Rprd1b or NM_027434"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Rprd1b
Synonyms 2610304G08Rik; 2810446G03Rik; Crept
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR204728 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCCTCCTTCTCAGAATCGGCGCTGGAAAAGAAGCTCTCAGAGCTGAGCAACTCTCAGCAGAGCGTGC
AGACCCTCTCCCTGTGGCTCATCCACCACCGCAAGCACGCAGGACCCATCGTCTCCGTGTGGCACCGCGA
GCTCCGCAAAGCCAAATCAAATAGAAAGCTTACTTTTCTATACTTAGCAAATGATGTCATCCAAAACAGT
AAAAGGAAAGGACCTGAGTTCACAAGAGAATTTGAGTCTGTGCTTGTGGATGCTTTTTCTCATGTTGCCA
GAGAGGCAGATGAAGGCTGTAAAAAACCTTTAGAAAGATTGCTGAACATCTGGCAAGAACGAAGTGTGTA
CGGCGGCGAGTTCATACAGCAGCTGAAGCTGTCTATGGAGGACTCCAAGAGCCCTCCCCCCAAAGCAGAA
GAGAAGAAGTCTCTAAAACGAACTTTTCAGCAGATACAAGAGGAGGAAGATGATGACTACCCTGGAAGCT
ACTCTCCCCAAGACCCTTCTGCAGGCCCTCTCTTGACTGAGGAGTTAATCAAAGCTTTGCAGGATCTGGA
AAATGCTGCGTCAGGGGATGCTACTGTCCGACAGAAGATCGCTTCCCTGCCTCAGGAAGTGCAAGACGTG
TCGCTGCTAGAGAAAATTACAGACAAAGAGGCAGCTGAACGTCTTTCAAAAACAGTAGATGAAGCATGTC
TGTTACTAGCGGAATATAACGGGCGCCTGGCAGCGGAACTGGAAGACCGGCGCCAGCTGGCTCGGATGCT
GGTGGAATACACCCAGAACCAGAAAGAGGTTTTGTCAGAAAAAGAGAAAAAACTAGAAGAGTATAAACAG
AAGCTTGCTCGAGTAACCCAGGTCCGCAAGGAACTCAAGTCCCACATTCAGAGCTTGCCAGACCTTTCGC
TGTTGCCTAATGTCACAGGGGGCCTGGCACCTCTGCCCTCTGCTGGTGACCTCTTTTCAACTGAC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>MR204728 protein sequence
Red=Cloning site Green=Tags(s)

MSSFSESALEKKLSELSNSQQSVQTLSLWLIHHRKHAGPIVSVWHRELRKAKSNRKLTFLYLANDVIQNS
KRKGPEFTREFESVLVDAFSHVAREADEGCKKPLERLLNIWQERSVYGGEFIQQLKLSMEDSKSPPPKAE
EKKSLKRTFQQIQEEEDDDYPGSYSPQDPSAGPLLTEELIKALQDLENAASGDATVRQKIASLPQEVQDV
SLLEKITDKEAAERLSKTVDEACLLLAEYNGRLAAELEDRRQLARMLVEYTQNQKEVLSEKEKKLEEYKQ
KLARVTQVRKELKSHIQSLPDLSLLPNVTGGLAPLPSAGDLFSTD

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_027434
ORF Size 975 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_027434.3
RefSeq Size 4517 bp
RefSeq ORF 978 bp
Locus ID 70470
UniProt ID Q9CSU0
Cytogenetics 2 H1
MW 36.8 kDa
Summary Interacts with phosphorylated C-terminal heptapeptide repeat domain (CTD) of the largest RNA polymerase II subunit POLR2A, and participates in dephosphorylation of the CTD. Transcriptional regulator which enhances expression of CCND1. Promotes binding of RNA polymerase II to the CCDN1 promoter and to the termination region before the poly-A site but decreases its binding after the poly-A site. Prevents RNA polymerase II from reading through the 3' end termination site and may allow it to be recruited back to the promoter through promotion of the formation of a chromatin loop. Also enhances the transcription of a number of other cell cycle-related genes including CDK2, CDK4, CDK6 and cyclin-E but not CDKN1A, CDKN1B or cyclin-A. Promotes cell proliferation (By similarity).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_027434" in other vectors (4)
SKU Description Size Price
MC201990 Rprd1b (untagged) - Mouse regulation of nuclear pre-mRNA domain containing 1B (Rprd1b), (10ug) 10 ug
$300.00
MG204728 Rprd1b (tGFP-tagged) - Mouse RIKEN cDNA 2610304G08 gene (2610304G08Rik) 10 ug
$500.00
MR204728L3 Lenti ORF clone of Rprd1b (Myc-DDK-tagged) - Mouse regulation of nuclear pre-mRNA domain containing 1B (Rprd1b) 10 ug
$600.00
MR204728L4 Lenti ORF clone of Rprd1b (mGFP-tagged) - Mouse regulation of nuclear pre-mRNA domain containing 1B (Rprd1b) 10 ug
$600.00

Plasmid Map for MR204728

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for MR204728
Circular map for MR204728

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products