OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Six1 (NM_009189) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MR203850
Six1 (Myc-DDK-tagged) - Mouse sine oculis-related homeobox 1 homolog (Drosophila) (Six1)
Interest in protein/lysate? Submit request here!
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
  $450.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA356002 Six1 Antibody - N-terminal region
100 ul
$585.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "Six1 or NM_009189"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Six1
Synonyms BB138287
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR203850 representing NM_009189
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCGATGCTGCCGTCGTTTGGTTTTACGCAAGAGCAAGTGGCGTGCGTGTGCGAAGTTCTGCAGCAAG
GAGGGAACCTGGAACGCCTGGGCAGGTTCTTGTGGTCGTTGCCCGCCTGCGATCACCTGCACAAGAACGA
GAGCGTGCTCAAGGCCAAGGCGGTGGTCGCCTTCCACCGCGGCAACTTCCGCGAGCTCTACAAGATACTG
GAGAGCCACCAGTTCTCGCCTCACAATCACCCCAAACTGCAGCAGCTGTGGCTGAAAGCGCACTACGTGG
AGGCCGAGAAACTTCGCGGCCGACCCCTGGGTGCCGTGGGCAAATATCGGGTGCGCCGAAAATTCCCGTT
GCCGCGGACCATCTGGGACGGCGAGGAGACCAGCTACTGCTTTAAGGAGAAGTCTCGGGGCGTGCTGCGG
GAGTGGTACGCGCACAACCCCTACCCCTCACCGAGGGAGAAACGGGAGCTGGCCGAGGCCACCGGCCTCA
CCACCACCCAGGTCAGCAACTGGTTTAAGAACCGGAGGCAAAGAGACCGGGCCGCCGAGGCCAAGGAAAG
GGAGAACACCGAAAACAATAACTCCTCCTCCAACAAGCAGAATCAACTCTCTCCTCTGGAAGGGGGCAAG
CCGCTCATGTCCAGCTCAGAAGAGGAGTTCTCACCCCCCCAAAGTCCAGACCAGAACTCGGTCCTTCTGC
TCCAGAGCAATATGGGCCACGCCAGGAGCTCAAACTATTCTCTTCCAGGCCTCACAGCCTCCCAGCCCAG
CCACGGTCTGCAAGCCCATCAGCACCAGCTCCAGGACTCTCTGCTGGGCCCACTCACCTCCAGTTTGGTG
GACTTGGGTTCC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>MR203850 representing NM_009189
Red=Cloning site Green=Tags(s)

MSMLPSFGFTQEQVACVCEVLQQGGNLERLGRFLWSLPACDHLHKNESVLKAKAVVAFHRGNFRELYKIL
ESHQFSPHNHPKLQQLWLKAHYVEAEKLRGRPLGAVGKYRVRRKFPLPRTIWDGEETSYCFKEKSRGVLR
EWYAHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAAEAKERENTENNNSSSNKQNQLSPLEGGK
PLMSSSEEEFSPPQSPDQNSVLLLQSNMGHARSSNYSLPGLTASQPSHGLQAHQHQLQDSLLGPLTSSLV
DLGS

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_009189
ORF Size 852 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_009189.3
RefSeq Size 2601 bp
RefSeq ORF 855 bp
Locus ID 20471
UniProt ID Q62231
Cytogenetics 12 30.34 cM
MW 32.7 kDa
Summary Transcription factor that is involved in the regulation of cell proliferation, apoptosis and embryonic development. Plays an important role in the development of several organs, including kidney, muscle and inner ear. Depending on context, functions as transcriptional repressor or activator. Lacks an activation domain, and requires interaction with EYA family members for transcription activation. Mediates nuclear translocation of EYA1 and EYA2. Binds the 5'-TCAAGAGTTNC-3' motif present in the MEF3 element in the MYOG promoter. Regulates the expression of numerous genes, including MYC, CCNA1, CCND1 and EZR. Acts as activator of the IGFBP5 promoter, probably coactivated by EYA2. Repression of precursor cell proliferation in myoblasts is switched to activation through recruitment of EYA3 to the SIX1-DACH1 complex. During myogenesis, seems to act together with EYA2 and DACH2.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_009189" in other vectors (4)
SKU Description Size Price
MC201713 Six1 (untagged) - Mouse sine oculis-related homeobox 1 homolog (Drosophila) (Six1), (10ug) 10 ug
$300.00
MG203850 Six1 (tGFP-tagged) - Mouse sine oculis-related homeobox 1 homolog (Drosophila) (Six1) 10 ug
$650.00
MR203850L3 Lenti ORF clone of Six1 (Myc-DDK-tagged) - Mouse sine oculis-related homeobox 1 homolog (Drosophila) (Six1) 10 ug
$750.00
MR203850L4 Lenti ORF clone of Six1 (mGFP-tagged) - Mouse sine oculis-related homeobox 1 homolog (Drosophila) (Six1) 10 ug
$750.00

Plasmid Map for MR203850

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for MR203850
Circular map for MR203850

file-alt Citations

Six1 promotes colorectal cancer growth and metastasis by stimulating angiogenesis and recruiting tumor-associated macrophages
Xu, Zhang, Peña et al
Carcinogenesis (2017)
AI Summary: OriGene's mouse Six1 cDNA was used to generate a construct (pcDNA3.1-mSix1) for Six1 overexpression experiments, enabling the study of Six1's role in colorectal cancer growth and metastasis.
Snippet: All cells were maintained in a humidified atmosphere of 5% CO 2 at 37°C. Six1 overexpression and knockdown. The mouse Six1 cDNA (Origene, Rockville, MD) was cloned into the EcoRI and NotI sites of pcDNA3.1. This construct is referred to as pcDNA3.1-mSix1. ... All 2 versions Cite SaveSaving
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products