OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Rab5a (NM_025887) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MR202355
Rab5a (Myc-DDK-tagged) - Mouse RAB5A, member RAS oncogene family (Rab5a)
Interest in protein/lysate? Submit request here!
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
$289.00 $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA357807 Rab5a Antibody - C-terminal region
100 ul
$585.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "Rab5a or NM_025887"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Rab5a
Synonyms 2410015H04Rik; AI663973; AU021172; nnyRab5a
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR202355 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTAATCGAGGAGCAACAAGACCCAACGGGCCAAATACTGGAAATAAAATATGCCAGTTCAAACTGG
TCCTTCTAGGAGAGTCTGCTGTTGGCAAATCAAGCCTGGTTCTTCGCTTTGTGAAAGGCCAATTTCATGA
ATTTCAAGAGAGTACCATTGGGGCTGCCTTTCTAACCCAAACTGTGTGTCTTGATGACACAACAGTAAAA
TTTGAAATATGGGATACAGCTGGTCAAGAACGGTATCATAGCTTAGCACCAATGTACTACCGAGGAGCAC
AAGCAGCCATAGTTGTGTATGATATCACAAATGAGGAATCCTTTGCGAGAGCAAAAAACTGGGTTAAAGA
ACTTCAAAGGCAAGCAAGTCCTAATATTGTGATAGCTTTGTCAGGAAACAAAGCTGACTTAGCAAATAAA
AGAGCTGTTGACTTCCAGGAAGCACAGTCCTATGCAGATGACAACAGCTTATTATTTATGGAGACATCAG
CTAAGACATCAATGAATGTAAATGAAATATTTATGGCAATAGCTAAAAAGCTGCCAAAGAATGAACCACA
GAATCCTGGTGCAAACTCAGCCAGAGGACGAGGAGTAGACCTTACTGAGCCTGCACAGCCAGCCAGAAGC
CAGTGTTGTAGTAAC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>MR202355 protein sequence
Red=Cloning site Green=Tags(s)

MANRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVK
FEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANK
RAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPAQPARS
QCCSN

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_025887
ORF Size 645 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_025887.4, NP_080163.1
RefSeq Size 2364 bp
RefSeq ORF 648 bp
Locus ID 271457
UniProt ID Q9CQD1
Cytogenetics 17 27.82 cM
MW 23.6 kDa
Summary The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different sets of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. RAB5A is required for the fusion of plasma membranes and early endosomes. Contributes to the regulation of filopodia extension. Required for the exosomal release of SDCBP, CD63, PDCD6IP and syndecan (By similarity). Regulates maturation of apoptotic cell-containing phagosomes, probably downstream of DYN2 and PIK3C3 (PubMed:18425118).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_025887" in other vectors (4)
SKU Description Size Price
MC207948 Rab5a (untagged) - Mouse RAB5A, member RAS oncogene family (Rab5a), (10ug) 10 ug
$330.00
MG202355 Rab5a (tGFP-tagged) - Mouse RAB5A, member RAS oncogene family (Rab5a) 10 ug
$489.00 $500.00
MR202355L3 Lenti ORF clone of Rab5a (Myc-DDK-tagged) - Mouse RAB5A, member RAS oncogene family (Rab5a) 10 ug
$600.00
MR202355L4 Lenti ORF clone of Rab5a (mGFP-tagged) - Mouse RAB5A, member RAS oncogene family (Rab5a) 10 ug
$600.00

Plasmid Map for MR202355

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for MR202355
Circular map for MR202355

file-alt Citations

Defining the TLT-1 interactome from resting and activated human platelets
Schmoker, Perez Pearson, Cruz et al
J Proteomics (2020) 215, 103638 DOI: 10.1016/j.jprot.2020.103638
Cited by 21
AI Summary: OriGene products, including MYC- and FLAG-tagged RAB7 (MR202190), RAB11A (MR202384), and pCMV6-Entry constructs, as well as pLX304 V5-tagged human TLT-1 (HsCD00436793) and RACK-1 (HsCD00441268), were used to express and study protein interactions for mapping the TLT-1 interactome in human platelets.
Snippet: (MR202355), RAB7 (MR202190), and RAB11A (MR202384) in pCMV6-Entry, tagged with MYC and FLAG sequences at C-termini, were obtained from Origene (Rockville, MD, USA). pLX304 V5-tagged human TLT-1 (HsCD00436793) and RACK-1 (HsCD00441268) constructs
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products