OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Pttg1 (BC023324) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MR202008
Pttg1 (Myc-DDK-tagged) - Mouse pituitary tumor-transforming 1 (cDNA clone MGC:35993 IMAGE:4946234)
Interest in protein/lysate? Submit request here!
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
$289.00 $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "Pttg1 or BC023324"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Pttg1
Synonyms PTTG
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR202008 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTACTCTTATCTTTGTTGATAAGGATAATGAAGAACCCGGCAGCCGTTTGGCTTCTAAGGATGGGT
TGAAGCTGGGCTCTGGTGTCAAGGCCTTAGATGGGAAATTGCAGGTTTCAACGCCTCGAGTCGGCAAAGT
GTTCAATGCTCCAGCCTTGCCTAAAGCCAGCAGAAAGGCTTTGGGGACAGTCAACAGAGTTGCCGAAAAG
CCTATGAAGACTGGTAAACCCCTCCAACCAAAACAGCCGACCTTGACTGGGAAAAAGATCACCGAGAAGT
CTACTAAGACACAAAGTTCTGTTCCTGCTCCTGATGATGCCTACCCAGAAATAGAAAAGTTCTTCCCTTT
CAATCCTCTAGATTTTGAGAGTTTTGACCTGCCTGAGGAGCACCAGATCTCACTTCTCCCCTTGAATGGC
GTGCCTCTCATGACCCTGAATGAAGAGAGAGGGCTGGAGAAGCTGCTGCATCTGGGCCCCCCTAGCCCTC
TGAAGACACCCTTTCTATCATGGGAATCTGATCCGCTGTACTCTCCTCCCAGTGCCCTCTCCACTCTGGA
TGTTGAATTGCCACCTGTTTGTTACGATGCAGATATT

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>MR202008 protein sequence
Red=Cloning site Green=Tags(s)

MATLIFVDKDNEEPGSRLASKDGLKLGSGVKALDGKLQVSTPRVGKVFNAPALPKASRKALGTVNRVAEK
PMKTGKPLQPKQPTLTGKKITEKSTKTQSSVPAPDDAYPEIEKFFPFNPLDFESFDLPEEHQISLLPLNG
VPLMTLNEERGLEKLLHLGPPSPLKTPFLSWESDPLYSPPSALSTLDVELPPVCYDADI

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN BC023324
ORF Size 597 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq BC023324, AAH23324
RefSeq Size 746 bp
RefSeq ORF 599 bp
Locus ID 30939
Cytogenetics 11 B1.1
MW 21.7 kDa
Summary Regulatory protein, which plays a central role in chromosome stability, in the p53/TP53 pathway, and DNA repair. Probably acts by blocking the action of key proteins. During the mitosis, it blocks Separase/ESPL1 function, preventing the proteolysis of the cohesin complex and the subsequent segregation of the chromosomes. At the onset of anaphase, it is ubiquitinated, conducting to its destruction and to the liberation of ESPL1. Its function is however not limited to a blocking activity, since it is required to activate ESPL1. Negatively regulates the transcriptional activity and related apoptosis activity of p53/TP53. The negative regulation of p53/TP53 may explain the strong transforming capability of the protein when it is overexpressed. May also play a role in DNA repair via its interaction with Ku, possibly by connecting DNA damage-response pathways with sister chromatid separation (By similarity).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"BC023324" in other vectors (4)
SKU Description Size Price
MC206872 Pttg1 (untagged) - Mouse pituitary tumor-transforming 1 (cDNA clone MGC:35993 IMAGE:4946234), (10ug) 10 ug
$330.00
MG202008 Pttg1 (tGFP-tagged) - Mouse pituitary tumor-transforming 1 (cDNA clone MGC:35993 IMAGE:4946234) 10 ug
$500.00
MR202008L3 Lenti ORF clone of Pttg1 (Myc-DDK-tagged) - Mouse pituitary tumor-transforming 1 (cDNA clone MGC:35993 IMAGE:4946234) 10 ug
$600.00
MR202008L4 Lenti ORF clone of Pttg1 (mGFP-tagged) - Mouse pituitary tumor-transforming 1 (cDNA clone MGC:35993 IMAGE:4946234) 10 ug
$600.00

Plasmid Map for MR202008

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for MR202008
Circular map for MR202008

file-alt Citations

Identification of disease-relevant modulators of the SHH pathway in the developing brain
Mecklenburg, Kowalczyk, Witte et al
Development (2021) 148 (17) DOI: 10.1242/dev.199307
Cited by 25
AI Summary: OriGene products cDNA Pttg1 (MR202008) and cDNA Ulk4 (MR217918) were used as overexpression constructs to investigate the role of these genes as modulators of SHH signaling in the developing brain.
Snippet: The following overexpression constructs were used: cDNA Pttg1 (Origene, MR202008), cDNA Ulk4 (Origene, MR217918), B9d1 RIKEN cDNA clone (Source Bioscience, 0710008G05), Tuba1c RIKEN cDNA clone (Source Bioscience, 2810407E13)
TCF1 links GIPR signaling to the control of beta cell function and survival
Campbell, Ussher, Mulvihill et al
Nat. Med. (2015) 22, 84-90 DOI: 10.1038/nm.3997
Cited by 148
AI Summary: OriGene contributed plasmid constructs (Tcf7 and Pttg1) and siRNAs (Gipr, Glp1r, Tcf7, TCF7) that were used to manipulate gene expression and investigate the roles of these genes in beta cell function and survival in the study.
Snippet: Peptides were reconstituted in phosphate-buffered saline (PBS), aliquoted and stored at –80 °C. [D-Ala2]GIP (GIP) was from Chi Scientific, Ex4 (exendin-4) was from California Peptide Research Inc. Plasmid constructs (Tcf7 and Pttg1) and siRNA (Gipr, Glp1r, Tcf7, TCF7) were from Origene. The GLP-1R antagonist (JANT-4)44 was a generous gift from R. DiMarchi, University of Indiana
Showing 1-2 of 2 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products