OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Il23a (NM_031252) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MR201920
Il23a (Myc-DDK-tagged) - Mouse interleukin 23, alpha subunit p19 (Il23a)
Interest in protein/lysate? Submit request here!
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
$289.00 $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "Il23a or NM_031252"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Il23a
Synonyms IL-23; p19
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR201920 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTGGATTGCAGAGCAGTAATAATGCTATGGCTGTTGCCCTGGGTCACTCAGGGCCTGGCTGTGCCTA
GGAGTAGCAGTCCTGACTGGGCTCAGTGCCAGCAGCTCTCTCGGAATCTCTGCATGCTAGCCTGGAACGC
ACATGCACCAGCGGGACATATGAATCTACTAAGAGAAGAAGAGGATGAAGAGACTAAAAATAATGTGCCC
CGTATCCAGTGTGAAGATGGTTGTGACCCACAAGGACTCAAGGACAACAGCCAGTTCTGCTTGCAAAGGA
TCCGCCAAGGTCTGGCTTTTTATAAGCACCTGCTTGACTCTGACATCTTCAAAGGGGAGCCTGCTCTACT
CCCTGATAGCCCCATGGAGCAACTTCACACCTCCCTACTAGGACTCAGCCAACTCCTCCAGCCAGAGGAT
CACCCCCGGGAGACCCAACAGATGCCCAGCCTGAGTTCTAGTCAGCAGTGGCAGCGCCCCCTTCTCCGTT
CCAAGATCCTTCGAAGCCTCCAGGCCTTTTTGGCCATAGCTGCCCGGGTCTTTGCCCACGGAGCAGCAAC
TCTGACTGAGCCCTTAGTGCCAACAGCT

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>MR201920 protein sequence
Red=Cloning site Green=Tags(s)

MLDCRAVIMLWLLPWVTQGLAVPRSSSPDWAQCQQLSRNLCMLAWNAHAPAGHMNLLREEEDEETKNNVP
RIQCEDGCDPQGLKDNSQFCLQRIRQGLAFYKHLLDSDIFKGEPALLPDSPMEQLHTSLLGLSQLLQPED
HPRETQQMPSLSSSQQWQRPLLRSKILRSLQAFLAIAARVFAHGAATLTEPLVPTA

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_031252
ORF Size 588 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_031252.2, NP_112542.1
RefSeq Size 1359 bp
RefSeq ORF 591 bp
Locus ID 83430
UniProt ID Q9EQ14
Cytogenetics 10 D3
MW 22.1 kDa
Summary Associates with IL12B to form the IL-23 interleukin, a heterodimeric cytokine which functions in innate and adaptive immunity. IL-23 may constitute with IL-17 an acute response to infection in peripheral tissues. IL-23 binds to a heterodimeric receptor complex composed of IL12RB1 and IL23R, activates the Jak-Stat signaling cascade, stimulates memory rather than naive T-cells and promotes production of proinflammatory cytokines. IL-23 induces autoimmune inflammation and thus may be responsible for autoimmune inflammatory diseases and may be important for tumorigenesis.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_031252" in other vectors (4)
SKU Description Size Price
MC201218 Il23a (untagged) - Mouse interleukin 23, alpha subunit p19 (Il23a), (10ug) 10 ug
$300.00
MG201920 Il23a (tGFP-tagged) - Mouse interleukin 23, alpha subunit p19 (Il23a) 10 ug
$500.00
MR201920L3 Lenti ORF clone of Il23a (Myc-DDK-tagged) - Mouse interleukin 23, alpha subunit p19 (Il23a) 10 ug
$600.00
MR201920L4 Lenti ORF clone of Il23a (mGFP-tagged) - Mouse interleukin 23, alpha subunit p19 (Il23a) 10 ug
$600.00

Plasmid Map for MR201920

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for MR201920
Circular map for MR201920

file-alt Citations

IL-17A treatment influences murine susceptibility to experimental Riemerella anatipestifer infection
Cammayo, Fernandez-Colorado, Flores et al
Dev. Comp. Immunol. (2020) 106, 103633 DOI: 10.1016/j.dci.2020.103633
Cited by 5
AI Summary: OriGene's recombinant mouse IL-23p19 protein was used to treat mice in order to investigate the role of IL-23 in susceptibility to Riemerella anatipestifer infection.
Snippet: 2.4. Cytokine treatment. Recombinant mouse IL-17A protein (Invitrogen, USA) and IL-23p19 protein (OriGene, USA) were purchased. Mice were randomly divided into infected and non-infected control groups, which were housed in separate buildings
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products