OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Nudt1 (NM_008637) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MR201165
Nudt1 (Myc-DDK-tagged) - Mouse nudix (nucleoside diphosphate linked moiety X)-type motif 1 (Nudt1)
Interest in protein/lysate? Submit request here!
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $289.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "Nudt1 or NM_008637"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Nudt1
Synonyms Mth1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR201165 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGCACCTCCAGGCTTTATACCCTTGTGCTAGTGCTACAGCCTCAGCGAGTTCTCCTGGGCATGAAGA
AGAGGGGCTTTGGTGCTGGCCGCTGGAATGGCTTCGGGGGCAAGGTGCAGGAAGGAGAGACCATTGAGGA
TGGGGCTAAGAGAGAGCTGCTGGAAGAAAGTGGTCTGAGCGTGGATACACTGCACAAGGTAGGCCACATC
TCGTTTGAATTTGTGGGCTCCCCTGAGCTGATGGACGTGCATATCTTCTCGGCTGACCATGTGCACGGGA
CGCCCACAGAGAGTGAAGAAATGCGCCCTCAGTGGTTCCAACTGGACCAGATCCCCTTTGCCGACATGTG
GCCGGATGACAGCTACTGGTTCCCACTCCTGCTTCAGAAGAAGAAGTTCTGTGGGCACTTCAAGTTCCAG
GATCAGGACACGATCCTCAGTTACTCGCTGCGAGAGGTGGACTCATTC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>MR201165 protein sequence
Red=Cloning site Green=Tags(s)

MSTSRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGAKRELLEESGLSVDTLHKVGHI
SFEFVGSPELMDVHIFSADHVHGTPTESEEMRPQWFQLDQIPFADMWPDDSYWFPLLLQKKKFCGHFKFQ
DQDTILSYSLREVDSF

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_008637
ORF Size 468 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_008637.1, NP_032663.1
RefSeq Size 939 bp
RefSeq ORF 471 bp
Locus ID 17766
UniProt ID P53368
Cytogenetics 5 G2
MW 17.9 kDa
Summary Antimutagenic (PubMed:11572992). Plays a redundant role in sanitizing oxidized nucleotide pools, such as 8-oxo-dGTP pools (PubMed:29281266). Acts as a sanitizing enzyme for oxidized nucleotide pools, thus suppressing cell dysfunction and death induced by oxidative stress. Hydrolyzes 8-oxo-dGTP, 8-oxo-dATP and 2-OH-dATP, thus preventing misincorporation of oxidized purine nucleoside triphosphates into DNA and subsequently preventing A:T to C:G and G:C to T:A transversions. Able to hydrolyze also the corresponding ribonucleotides, 2-OH-ATP, 8-oxo-GTP and 8-oxo-ATP (By similarity). Does not play a role in U8 snoRNA decapping activity (PubMed:21070968). Binds U8 snoRNA (PubMed:21070968).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_008637" in other vectors (4)
SKU Description Size Price
MC204305 Nudt1 (untagged) - Mouse nudix (nucleoside diphosphate linked moiety X)-type motif 1 (Nudt1), (10ug) 10 ug
$150.00
MG201165 Nudt1 (tGFP-tagged) - Mouse nudix (nucleoside diphosphate linked moiety X)-type motif 1 (Nudt1) 10 ug
$350.00
MR201165L3 Lenti ORF clone of Nudt1 (Myc-DDK-tagged) - Mouse nudix (nucleoside diphosphate linked moiety X)-type motif 1 (Nudt1) 10 ug
$450.00
MR201165L4 Lenti ORF clone of Nudt1 (mGFP-tagged) - Mouse nudix (nucleoside diphosphate linked moiety X)-type motif 1 (Nudt1) 10 ug
$450.00

Plasmid Map for MR201165

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for MR201165
Circular map for MR201165

file-alt Citations

MTH1 favors mesothelioma progression and mediates paracrine rescue of bystander endothelium from oxidative damage
Magkouta, Pappas, Vaitsi et al
JCI Insight (2020) 5 (12) DOI: 10.1172/jci.insight.134885
Cited by 15
AI Summary: OriGene’s Nudt1 (NM_008637) ORF clone was used to create AE17 mesothelioma cells overexpressing MTH1, enabling the study of MTH1’s role in tumor progression and response to inhibition.
Snippet: Cached;All cell lines were maintained in DMEM (10% FBS). AE17 cells overexpressing MTH1 were created upon stable transfection with Nudt1 (NM_008637) ORF clone (Origene Technologies Inc.)
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products