Nudt1 (NM_008637) Mouse Tagged ORF Clone

SKU
MG201165
Nudt1 (tGFP-tagged) - Mouse nudix (nucleoside diphosphate linked moiety X)-type motif 1 (Nudt1)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$350.00
3 Weeks*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Nudt1
Synonyms Mth1
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG201165 representing NM_008637
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGCACCTCCAGGCTTTATACCCTTGTGCTAGTGCTACAGCCTCAGCGAGTTCTCCTGGGCATGAAGA
AGAGGGGCTTTGGTGCTGGCCGCTGGAATGGCTTCGGGGGCAAGGTGCAGGAAGGAGAGACCATTGAGGA
TGGGGCTAAGAGAGAGCTGCTGGAAGAAAGTGGTCTGAGCGTGGATACACTGCACAAGGTAGGCCACATC
TCGTTTGAATTTGTGGGCTCCCCTGAGCTGATGGACGTGCATATCTTCTCGGCTGACCATGTGCACGGGA
CGCCCACAGAGAGTGAAGAAATGCGCCCTCAGTGGTTCCAACTGGACCAGATCCCCTTTGCCGACATGTG
GCCGGATGACAGCTACTGGTTCCCACTCCTGCTTCAGAAGAAGAAGTTCTGTGGGCACTTCAAGTTCCAG
GATCAGGACACGATCCTCAGTTACTCGCTGCGAGAGGTGGACTCATTC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG201165 representing NM_008637
Red=Cloning site Green=Tags(s)

MSTSRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGAKRELLEESGLSVDTLHKVGHI
SFEFVGSPELMDVHIFSADHVHGTPTESEEMRPQWFQLDQIPFADMWPDDSYWFPLLLQKKKFCGHFKFQ
DQDTILSYSLREVDSF

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_008637
ORF Size 468 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_008637.1, NP_032663.1
RefSeq Size 939 bp
RefSeq ORF 471 bp
Locus ID 17766
UniProt ID P53368
Cytogenetics 5 G2
Summary Antimutagenic (PubMed:11572992). Plays a redundant role in sanitizing oxidized nucleotide pools, such as 8-oxo-dGTP pools (PubMed:29281266). Acts as a sanitizing enzyme for oxidized nucleotide pools, thus suppressing cell dysfunction and death induced by oxidative stress. Hydrolyzes 8-oxo-dGTP, 8-oxo-dATP and 2-OH-dATP, thus preventing misincorporation of oxidized purine nucleoside triphosphates into DNA and subsequently preventing A:T to C:G and G:C to T:A transversions. Able to hydrolyze also the corresponding ribonucleotides, 2-OH-ATP, 8-oxo-GTP and 8-oxo-ATP (By similarity). Does not play a role in U8 snoRNA decapping activity (PubMed:21070968). Binds U8 snoRNA (PubMed:21070968).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Nudt1 (NM_008637) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC204305 Nudt1 (untagged) - Mouse nudix (nucleoside diphosphate linked moiety X)-type motif 1 (Nudt1), (10ug) 10 ug
$150.00
MR201165 Nudt1 (Myc-DDK-tagged) - Mouse nudix (nucleoside diphosphate linked moiety X)-type motif 1 (Nudt1) 10 ug
$289.00
MR201165L3 Lenti ORF clone of Nudt1 (Myc-DDK-tagged) - Mouse nudix (nucleoside diphosphate linked moiety X)-type motif 1 (Nudt1) 10 ug
$450.00
MR201165L4 Lenti ORF clone of Nudt1 (mGFP-tagged) - Mouse nudix (nucleoside diphosphate linked moiety X)-type motif 1 (Nudt1) 10 ug
$450.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.