OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

alpha 1 Antitrypsin (SERPINA1) (NM_000295) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC202082
SERPINA1 (Myc-DDK-tagged)-Human serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 1
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $457.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA500374 Anti-SERPINA1 mouse monoclonal antibody, clone OTI9A1 (formerly 9A1) 100 ul
$447.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "alpha 1 Antitrypsin or NM_000295"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol alpha 1 Antitrypsin
Synonyms A1A; A1AT; AAT; alpha1AT; nNIF; PI; PI1; PRO2275
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC202082 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCGTCTTCTGTCTCGTGGGGCATCCTCCTGCTGGCAGGCCTGTGCTGCCTGGTCCCTGTCTCCCTGG
CTGAGGATCCCCAGGGAGATGCTGCCCAGAAGACAGATACATCCCACCATGATCAGGATCACCCAACCTT
CAACAAGATCACCCCCAACCTGGCTGAGTTCGCCTTCAGCCTATACCGCCAGCTGGCACACCAGTCCAAC
AGCACCAATATCTTCTTCTCCCCAGTGAGCATCGCTACAGCCTTTGCAATGCTCTCCCTGGGGACCAAGG
CTGACACTCACGATGAAATCCTGGAGGGCCTGAATTTCAACCTCACGGAGATTCCGGAGGCTCAGATCCA
TGAAGGCTTCCAGGAACTCCTCCGTACCCTCAACCAGCCAGACAGCCAGCTCCAGCTGACCACCGGCAAT
GGCTTGTTCCTCAGCGAGGGCCTGAAGCTAGTGGATAAGTTTTTGGAGGATGTTAAAAAGTTGTACCACT
CAGAAGCCTTCACTGTCAACTTCGGGGACACCGAAGAGGCCAAGAAACAGATCAACGATTACGTGGAGAA
GGGTACTCAAGGGAAAATTGTGGATTTGGTCAAGGAGCTTGACAGAGACACAGTTTTTGCTCTGGTGAAT
TACATCTTCTTTAAAGGCAAATGGGAGAGACCCTTTGAAGTCAAGGACACCGAGGAAGAGGACTTCCACG
TGGACCAGGTGACCACCGTGAAGGTGCCTATGATGAAGCGTTTAGGCATGTTTAACATCCAGCACTGTAA
GAAGCTGTCCAGCTGGGTGCTGCTGATGAAATACCTGGGCAATGCCACCGCCATCTTCTTCCTGCCTGAT
GAGGGGAAACTACAGCACCTGGAAAATGAACTCACCCACGATATCATCACCAAGTTCCTGGAAAATGAAG
ACAGAAGGTCTGCCAGCTTACATTTACCCAAACTGTCCATTACTGGAACCTATGATCTGAAGAGCGTCCT
GGGTCAACTGGGCATCACTAAGGTCTTCAGCAATGGGGCTGACCTCTCCGGGGTCACAGAGGAGGCACCC
CTGAAGCTCTCCAAGGCCGTGCATAAGGCTGTGCTGACCATCGACGAGAAAGGGACTGAAGCTGCTGGGG
CCATGTTTTTAGAGGCCATACCCATGTCTATCCCCCCCGAGGTCAAGTTCAACAAACCCTTTGTCTTCTT
AATGATTGACCAAAATACCAAGTCTCCCCTCTTCATGGGAAAAGTGGTGAATCCCACCCAAAAA

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC202082 protein sequence
Red=Cloning site Green=Tags(s)

MPSSVSWGILLLAGLCCLVPVSLAEDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSN
STNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGN
GLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVN
YIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPD
EGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAP
LKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIDQNTKSPLFMGKVVNPTQK

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_000295
ORF Size 1254 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_000295.2
RefSeq Size 3220 bp
RefSeq ORF 1257 bp
Locus ID 5265
UniProt ID P01009, E9KL23
Cytogenetics 14q32.13
Domains SERPIN
Protein Families Druggable Genome, ES Cell Differentiation/IPS, Secreted Protein
Protein Pathways Complement and coagulation cascades
MW 46.7 kDa
Summary The protein encoded by this gene is a serine protease inhibitor belonging to the serpin superfamily whose targets include elastase, plasmin, thrombin, trypsin, chymotrypsin, and plasminogen activator. This protein is produced in the liver, the bone marrow, by lymphocytic and monocytic cells in lymphoid tissue, and by the Paneth cells of the gut. Defects in this gene are associated with chronic obstructive pulmonary disease, emphysema, and chronic liver disease. Several transcript variants encoding the same protein have been found for this gene. provided by RefSeq, Aug 2020
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_000295" in other vectors (7)
SKU Description Size Price
RC202082L1 Lenti ORF clone of Human serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 1, Myc-DDK-tagged 10 ug
$757.00
RC202082L2 Lenti ORF clone of Human serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 1, mGFP tagged 10 ug
$757.00
RC202082L3 Lenti ORF clone of Human serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 1, Myc-DDK-tagged 10 ug
$757.00
RC202082L4 Lenti ORF clone of Human serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 1, mGFP tagged 10 ug
$757.00
RG202082 SERPINA1 (tGFP-tagged) - Human serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 1 10 ug
$489.00 $657.00
SC119951 SERPINA1 (untagged)-Human serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 1 10 ug
$457.00
SC322312 SERPINA1 (untagged)-Human serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 1 10 ug
$457.00

Plasmid Map for RC202082

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC202082
Circular map for RC202082

file-alt Citations

Membralin Assembles a MAN1B1-VCP Complex to Target Foreign Glycoproteins from the Endoplasmic Reticulum to Lysosomes for Degradation
Zhang, Lu, Li et al
Adv Sci (Weinh) (2025)
Cited by 7
AI Summary: OriGene products, specifically the pCMV6-CD3D-Myc-FLAG, pCMV6-NCSTN-Myc-FLAG, and pCMV6-VCP-Myc-FLAG plasmids (Cat# RC202082, RC218041, RC219485, RC210010, RC212646, RC211130), were used in this study to express and analyze key proteins involved in the Membralin-MAN1B1-VCP complex that mediates selective degradation of foreign glycoproteins in the endoplasmic reticulum.
Snippet: pCMV6-CD3D-Myc-FLAG, pCMV6-NCSTN-Myc-FLAG, and pCMV6-VCP-Myc-FLAG were ordered from Origene (Cat# RC202082, RC218041, RC219485, RC210010, RC212646, RC211130). SERPINA1/AAT, NPC1, COL2A1, and DYSF
Membralin Selects Foreign Glycoproteins from the Endoplasmic Reticulum to Lysosomes for Degradation
Zheng, Zhang, Lu et al
Research Square (2025)
Cited by 1
AI Summary: OriGene products, including pCMV6-SERPINA1-Myc-Flag, pCMV6-COL2A1-Myc-Flag, pCMV6-DYSF-Myc-Flag, pCMV6-CD3D-Myc-Flag, pCMV6-NCSTN-Myc-Flag, and pCMV6-VCP-Myc-FLAG, were used as expression plasmids to study the roles of various proteins in Membralin-mediated degradation of foreign glycoproteins in the endoplasmic reticulum.
Snippet: pCDNA3.1-NHK was provided by Richard Sifers. pCMV6-SERPINA1-Myc-Flag, pCMV6-COL2A1-Myc-Flag, pCMV6-DYSF-Myc-Flag, pCMV6-CD3D-Myc-Flag, pCMV6-NCSTN-Myc-Flag, and pCMV6-VCP-Myc-FLAG were ordered from Origene (Cat# RC202082, RC218041, RC219485, RC210010, RC212646, RC211130). SERPINA1/AAT, NPC1, COL2A1, and DYSF mutants and pCMV6-VCP-His were created by PCR and ASiSI/MluI digestion followed by homol
Characterization of Novel Missense Variants of SERPINA1 Gene Causing Alpha-1 Antitrypsin Deficiency
Matamala, Lara, Gomez-Mariano et al
Am. J. Respir. Cell Mol. Biol. (2017)
AI Summary: OriGene’s pCMV6 expression vector containing AAT M1(Val213) cDNA was used to express the newly identified SERPINA1 gene variants in HEK293T cells for functional analysis in this study.
Snippet: Madison, WI, USA), introduced into E. coli DH5α and sequenced. Expression plasmids and DNA transfection The expression vector pCMV6 (OriGene, Rockville, MD, USA) with AAT M1(Val213) cDNA was used for expression of the new identified SERPINA1 variants
Serpin peptidase inhibitor clade A member 1 is a biomarker of poor prognosis in gastric cancer
Kwon, Park, Lee et al
Br. J. Cancer (2014)
Cited by 58
AI Summary: OriGene’s pcDNA Snail-Myc and pcDNA SerpinA1-Myc expression vectors were used to overexpress Snail and SerpinA1 in gastric cancer cells, enabling the study of their roles in cancer cell migration and invasion.
Snippet: For overexpression of genes, cells were grown to 60–70% confluence and transfected with the pcDNA Snail-Myc or pcDNA SerpinA1-Myc vectors (Origene, Rockville, MD, USA), or with the pcDNA-3.1 vector as a control, with Lipofectamine 2000 (Invitrogen, Carlsbad ... Cite SaveSaving
Showing 1-4 of 4 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products