OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Cav1 (NM_007616) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MR201562
Cav1 (Myc-DDK-tagged) - Mouse caveolin 1, caveolae protein (Cav1)
Interest in protein/lysate? Submit request here!
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
$289.00 $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "Cav1 or NM_007616"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Cav1
Synonyms Cav; Cav-1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR201562 representing NM_007616
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCTGGGGGCAAATACGTAGACTCCGAGGGACATCTCTACACTGTTCCCATCCGGGAACAGGGCAACA
TCTACAAGCCCAACAACAAGGCCATGGCAGACGAGGTGACTGAGAAGCAAGTGTATGACGCGCACACCAA
GGAGATTGACCTGGTCAACCGCGACCCCAAGCATCTCAACGACGACGTGGTCAAGATTGACTTTGAAGAT
GTGATTGCAGAACCAGAAGGGACACACAGTTTCGACGGCATCTGGAAGGCCAGCTTCACCACCTTCACTG
TGACAAAATATTGGTTTTACCGCTTGTTGTCTACGATCTTCGGCATCCCAATGGCACTCATCTGGGGCAT
TTACTTTGCCATTCTCTCCTTCCTGCACATCTGGGCGGTTGTACCGTGCATCAAGAGCTTCCTGATTGAG
ATTCAGTGCATCAGCCGCGTCTACTCCATCTACGTCCATACCTTCTGCGATCCACTCTTTGAAGCTATTG
GCAAGATATTCAGCAACATCCGCATCAGCACGCAGAAAGAGATA

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>MR201562 representing NM_007616
Red=Cloning site Green=Tags(s)

MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADEVTEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFED
VIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSTIFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIE
IQCISRVYSIYVHTFCDPLFEAIGKIFSNIRISTQKEI

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_007616
ORF Size 534 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_007616.4
RefSeq Size 2487 bp
RefSeq ORF 537 bp
Locus ID 12389
UniProt ID P49817
Cytogenetics 6 A2
MW 21 kDa
Summary May act as a scaffolding protein within caveolar membranes (By similarity). Forms a stable heterooligomeric complex with CAV2 that targets to lipid rafts and drives caveolae formation. Mediates the recruitment of CAVIN proteins (CAVIN1/2/3/4) to the caveolae (PubMed:19546242). Interacts directly with G-protein alpha subunits and can functionally regulate their activity (By similarity). Involved in the costimulatory signal essential for T-cell receptor (TCR)-mediated T-cell activation. Its binding to DPP4 induces T-cell proliferation and NF-kappa-B activation in a T-cell receptor/CD3-dependent manner (By similarity). Recruits CTNNB1 to caveolar membranes and may regulate CTNNB1-mediated signaling through the Wnt pathway (PubMed:10816572). Negatively regulates TGFB1-mediated activation of SMAD2/3 by mediating the internalization of TGFBR1 from membrane rafts leading to its subsequent degradation (By similarity).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_007616" in other vectors (4)
SKU Description Size Price
MC202054 Cav1 (untagged) - Mouse caveolin 1, caveolae protein (Cav1), (10ug) 10 ug
$300.00
MG201562 tGFP-tagged ORF clone of Mus musculus caveolin, caveolae protein 1 (Cav1) 10 ug
$489.00 $500.00
MR201562L3 Lenti ORF clone of Cav1 (Myc-DDK-tagged) - Mouse caveolin 1, caveolae protein (Cav1) 10 ug
$600.00
MR201562L4 Lenti ORF clone of Cav1 (mGFP-tagged) - Mouse caveolin 1, caveolae protein (Cav1) 10 ug
$600.00

Plasmid Map for MR201562

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for MR201562
Circular map for MR201562

file-alt Citations

Cellular senescence induced by cholesterol accumulation is mediated by lysosomal ABCA1 in APOE4 and AD
Wang, Li, Li et al
Mol Neurodegener (2025) 20 (1), 15 DOI: 10.1186/s13024-025-00802-7
Cited by 40
AI Summary: OriGene’s mouse Caveolin-1 (Myc-DDK-tagged) expression plasmid (catalog #MR201562) was used to study the role of caveolin-1 in ABCA1 trafficking and cellular senescence in the context of cholesterol accumulation in Alzheimer’s disease models.
Snippet: s Transfection, catalog #114). Protein expression was detected using western blotting 48 h after transfection. The mouse Caveolin-1 (Myc-DDK-tagged) expression plasmid (MR201562) was purchased from Origene and purified using an endo-free plasmid DNA midi kit (Bioland Scientific, PD03-21). The pCMV-GFP expression plasmid was used as the control. The cells were seeded in 24-well plates and culture
FigureFigureFigure
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products