Helt (NM_173789) Mouse Recombinant Protein
SKU
TP525375
Purified recombinant protein of Mouse helt bHLH transcription factor (Helt), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
$988.00
4 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Mouse |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>MR225375 protein sequence
Red=Cloning site Green=Tags(s) MSDRLKERKRTPVSHKVIEKRRRDRINRCLNELGKTVPMALAKQSSGKLEKAEILEMTVQYLRALHSADF PRGREKELLAEFANYFHYGYHECMKNLVHYLTTVERMETKDTKYARILAFLQSKARLGAEPTFPPLSLPE PDFSYQLHAASPEFPGHSPGEATMFPQGATPGSFPWPPGAARSPALPYLSSATVPLPSPAQQHSPFLAPM QGLDRHYLNLIGHGHPNGLNLHTPQHPPVL myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 27 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_776150 |
Locus ID | 234219 |
UniProt ID | Q7TS99 |
Cytogenetics | 8 26.32 cM |
RefSeq Size | 1548 |
RefSeq ORF | 720 |
Synonyms | A830086M02; Hesl; Heslike; megane; Mgn |
Summary | Transcriptional repressor which binds preferentially to the canonical E box sequence 5'-CACGCG-3'. Required for the development of GABAergic neurons.[UniProtKB/Swiss-Prot Function] |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.