Helt Rabbit Polyclonal Antibody

SKU TA329607

Rabbit polyclonal anti-Helt Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Helt antibody is: synthetic peptide directed towards the C-terminal region of Mouse Helt. Synthetic peptide located within the following region: LPEPDFSYQLHAASPEFPGHSPGEATMFPQGATPGSFPWPPGAARSPALP
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 27 kDa
• Gene Name: helt bHLH transcription factor
• Database Link:
  NP_776150
  Q7TS99
• Background: Helt is a transcriptional repressor which binds preferentially to the canonical E box sequence 5'-CACGCG-3' and is required for the development of GABAergic neurons.
• Synonyms: HCM1228; HES-like; HESL; Heslike; Mgn
• Note: Immunogen sequence homology: Mouse: 100%; Rat: 93%; Horse: 85%; Human: 85%; Bovine: 85%; Pig: 77%; Rabbit: 77%; Guinea pig: 77%

Reference Data