Helt Rabbit Polyclonal Antibody
Product Data | |
Application | WB |
---|---|
Recommended Dilution | WB |
Reactivity | Mouse |
Antibody Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-Helt antibody is: synthetic peptide directed towards the C-terminal region of Mouse Helt. Synthetic peptide located within the following region: LPEPDFSYQLHAASPEFPGHSPGEATMFPQGATPGSFPWPPGAARSPALP |
Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Shipping | Blue Ice |
Predicted Protein Size | 27 kDa |
Gene Name | helt bHLH transcription factor |
Database Link | |
Background | Helt is a transcriptional repressor which binds preferentially to the canonical E box sequence 5'-CACGCG-3' and is required for the development of GABAergic neurons. |
Synonyms | HCM1228; HES-like; HESL; Heslike; Mgn |
Note | Immunogen sequence homology: Mouse: 100%; Rat: 93%; Horse: 85%; Human: 85%; Bovine: 85%; Pig: 77%; Rabbit: 77%; Guinea pig: 77% |
Reference Data |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.