Cpne7 (NM_170684) Mouse Recombinant Protein

CAT#: TP519091

Purified recombinant protein of Mouse copine VII (Cpne7), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Product Images

Purified recombinant protein Cpne7 was analyzed by SDS-PAGE gel and Coomossie Blue Staining.

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR219091 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSGDSERAVAPGVVPAPCASKVELRLSCRHLLDRDPLTKSDPSVVLLQQAQGQWLQVDRTEVVKSSLHPV
  FSKVFTVDYYFEGVQKLRFEVYDTHGPSGLTCQDDDFLGGMECTLGQIVAQKKMTRPLLLRFGRNAGKST
  ITVIAEDISGNNGYVELSFQARKLDDKDLFSKSDPFLELYRVNDDGSEQLVYRTEVVKNNLNPVWEPFKV
  SLNSLCSCEETRPLKCLVWDYDSRGKHDFIGDFTTTFAEMQKAFEEEQQAQWDCVNAKYKQKKRNYKNSG
  VVILADLKLHRVHSFLDYIMGGCQIHCTVAIDFTASNGDPRNSCSLHHINPYQPNEYLRALVAVGEVCQD
  YDSDKRFSALGFGARIPPKYEVSHDFAINFNPEDDECEGIQGVVEAYQNCLPKVQLYGPTNVAPIISKVA
  RMAAAEESTGEASQYYILLILTDGVVTDMSDTREAIVRASHLPMSVIIVGVGNADFTDMQILDGDDGVLR
  SPRGEPALRDIVQFVPFRELKNASPAALAKCVLAEVPKQVVEYYSHKELPPRSLGAQTGEAAASSAP
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 61.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_733785
• Locus ID: 102278
• UniProt ID: Q0VE82
• Cytogenetics: 8 E1
• Refseq Size: 2421
• Refseq ORF: 1674
• Synonyms: AW047065
• Summary: Calcium-dependent membrane-binding proteins may regulate molecular events at the interface of the cell membrane and cytoplasm. This gene is one of several genes that encodes a calcium-dependent protein containing two N-terminal type II C2 domains and an integrin A domain-like sequence in the C-terminus. [provided by RefSeq, Jul 2008]