OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Cpne7 Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA334534
Rabbit Polyclonal Anti-Cpne7 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (1)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00

View other "Cpne7 or NM_170684" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Mouse
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-Cpne7 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: GARIPPKYEVSHDFAINFNPEDDECEGIQGVVEAYQNCLPKVQLYGPTNV
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 61 kDa
Gene Name copine VII
Database Link
Background Calcium-dependent membrane-binding proteins may regulate molecular events at the interface of the cell membrane and cytoplasm. This gene is one of several genes that encodes a calcium-dependent protein containing two N-terminal type II C2 domains and an integrin A domain-like sequence in the C-terminus.
Synonyms MGC34192
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Zebrafish: 100%; Guinea pig: 100%; Horse: 90%; Rabbit: 85%
Reference Data
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

Copine-7 is required for REM sleep regulation following cage change or water immersion and restraint stress in mice
Liu, Tsai, Yasugaki et al
Neurosci. Res. (2020)
Cited by 9
AI Summary: OriGene’s anti-copine-7 antibody (TA334534) was used in this study to detect copine-7 protein, enabling the authors to investigate its role in REM sleep regulation in mice.
Snippet: For detecting copine-7, anti-copine-7 antibody (1/1000: rabbit anti-copine-7 (Origene;TA334534)) and HRP-labeled anti-rabbit IgG antibody (1/1000: donkey anti-rabbit IgG-HRP (Abcam;ab7083)) were used as a primary and secondary antibody, respectively;- For detecting copine-7, anti-copine-7 antibody (1/1000: rabbit anti-copine-7 (Origene
Copine-7 binds to the cell surface receptor, nucleolin, and regulates ciliogenesis and Dspp expression during odontoblast differentiation
Seo, Park, Lee et al
Sci Rep (2017) 7 (1), 11283 DOI: 10.1038/s41598-017-11641-y
AI Summary: OriGene contributed to this study by providing the DDK (Flag)-tagged Cpne7 expression vector (NM_153636) and recombinant Cpne7 protein (NP_705900), which were used to investigate the role of Cpne7 in odontoblast differentiation and ciliogenesis.
Snippet: Expression vectors encoding DDK (Flag)-tagged Cpne7 ({"type":"entrez-nucleotide"," attrs":{"text":"NM_153636","term_id":"214830517","term_text":"NM_153636"}}NM_153636) and recombinant Cpne7 (NP 705900) were purchased from Origene (Rockville, MD, USA
FigureFigureFigure
Showing 1-2 of 2 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products