FXYD6 (NM_001164836) Human Recombinant Protein

CAT#: TP328721

Purified recombinant protein of Homo sapiens FXYD domain containing ion transport regulator 6 (FXYD6), transcript variant 4, 20 µg

Product Images

Coomassie blue staining of purified FXYD6 protein (Cat# TP328721). The protein was produced from HEK293T cells transfected with FXYD6 cDNA clone (Cat# RC228721) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC228721 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MELVLVFLCSLLAPMVLASAAEKEKEMDPFHYDYQTLRIGGLVFAVVLFSVGILLILSRRCKCSFNQKPR
  APGDEEAQVENLITANATEPQKAEN
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 10.4 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001158308
• Locus ID: 53826
• UniProt ID: Q9H0Q3, A0A024R3J8
• Cytogenetics: 11q23.3
• Refseq Size: 2229
• Refseq ORF: 285
• Summary: This gene encodes a member of the FXYD family of transmembrane proteins. This particular protein encodes phosphohippolin, which likely affects the activity of Na,K-ATPase. Multiple alternatively spliced transcript variants encoding the same protein have been described. Related pseudogenes have been identified on chromosomes 10 and X. Read-through transcripts have been observed between this locus and the downstream sodium/potassium-transporting ATPase subunit gamma (FXYD2, GeneID 486) locus.[provided by RefSeq, Feb 2011]
• Protein Families: Ion Channels: Other, Transmembrane