OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

FXYD6 (NM_001164836) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP328721
Purified recombinant protein of Homo sapiens FXYD domain containing ion transport regulator 6 (FXYD6), transcript variant 4, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA365922 FXYD6 rabbit polyclonal antibody
100 ul
$310.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "FXYD6 or NM_001164836"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC228721 protein sequence
Red=Cloning site Green=Tags(s)

MELVLVFLCSLLAPMVLASAAEKEKEMDPFHYDYQTLRIGGLVFAVVLFSVGILLILSRRCKCSFNQKPR
APGDEEAQVENLITANATEPQKAEN

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 10.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001158308
Locus ID 53826
UniProt ID Q9H0Q3
Cytogenetics 11q23.3
RefSeq Size 2229
RefSeq ORF 285
Summary This gene encodes a member of the FXYD family of transmembrane proteins. This particular protein encodes phosphohippolin, which likely affects the activity of Na,K-ATPase. Multiple alternatively spliced transcript variants encoding the same protein have been described. Related pseudogenes have been identified on chromosomes 10 and X. Read-through transcripts have been observed between this locus and the downstream sodium/potassium-transporting ATPase subunit gamma (FXYD2, GeneID 486) locus.provided by RefSeq, Feb 2011
Protein Categories Membrane Proteins
Protein Families Ion Channels: Other, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "FXYD6" proteins (13)
SKU Description Size Price
PH310607 FXYD6 MS Standard C13 and N15-labeled recombinant protein (NP_071286) 10 ug
$3,360.00
LC411842 Lyophilized FXYD6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC431748 Lyophilized FXYD6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC431749 Lyophilized FXYD6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC431750 Lyophilized FXYD6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC431751 Lyophilized FXYD6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY411842 Transient overexpression lysate of FXYD domain containing ion transport regulator 6 (FXYD6), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY431748 Transient overexpression lysate of FXYD domain containing ion transport regulator 6 (FXYD6), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY431749 Transient overexpression lysate of FXYD domain containing ion transport regulator 6 (FXYD6), transcript variant 4 (as WB positive control) 100 ug
$436.00
LY431750 Transient overexpression lysate of FXYD domain containing ion transport regulator 6 (FXYD6), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY431751 Transient overexpression lysate of FXYD domain containing ion transport regulator 6 (FXYD6), transcript variant 5 (as WB positive control) 100 ug
$436.00
TP310607 Recombinant protein of human FXYD domain containing ion transport regulator 6 (FXYD6), 20 µg 20 ug
$867.00
TP328720 Purified recombinant protein of Homo sapiens FXYD domain containing ion transport regulator 6 (FXYD6), transcript variant 3, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products