FXYD6 (NM_022003) Human Mass Spec Standard

SKU PH310607

FXYD6 MS Standard C13 and N15-labeled recombinant protein (NP_071286)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC210607]
• Predicted MW: 10.5 kDa
• Protein Sequence:
  Protein Sequence

  >RC210607 protein sequence; Red=Cloning site Green=Tags(s); ; MELVLVFLCSLLAPMVLASAAEKEKEMDPFHYDYQTLRIGGLVFAVVLFSVGILLILSRRCKCSFNQKPR; APGDEEAQVENLITANATEPQKAEN; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_071286
• RefSeq Size: 2056
• RefSeq ORF: 285
• Locus ID: 53826
• UniProt ID: Q9H0Q3
• Cytogenetics: 11q23.3
• Summary: This gene encodes a member of the FXYD family of transmembrane proteins. This particular protein encodes phosphohippolin, which likely affects the activity of Na,K-ATPase. Multiple alternatively spliced transcript variants encoding the same protein have been described. Related pseudogenes have been identified on chromosomes 10 and X. Read-through transcripts have been observed between this locus and the downstream sodium/potassium-transporting ATPase subunit gamma (FXYD2, GeneID 486) locus.[provided by RefSeq, Feb 2011]
• Protein Families: Ion Channels: Other, Transmembrane