OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

FXYD6 (NM_022003) Human Mass Spec Standard

Be the first to review this product
SKU
PH310607
FXYD6 MS Standard C13 and N15-labeled recombinant protein (NP_071286)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA365922 FXYD6 rabbit polyclonal antibody
100 ul
$310.00
LY411842 Transient overexpression lysate of FXYD domain containing ion transport regulator 6 (FXYD6), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "FXYD6 or NM_022003"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC210607
Predicted MW 10.5 kDa
Protein Sequence
Protein Sequence
>RC210607 protein sequence
Red=Cloning site Green=Tags(s)

MELVLVFLCSLLAPMVLASAAEKEKEMDPFHYDYQTLRIGGLVFAVVLFSVGILLILSRRCKCSFNQKPR
APGDEEAQVENLITANATEPQKAEN

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_071286
RefSeq Size 2056
RefSeq ORF 285
Locus ID 53826
UniProt ID Q9H0Q3
Cytogenetics 11q23.3
Summary This gene encodes a member of the FXYD family of transmembrane proteins. This particular protein encodes phosphohippolin, which likely affects the activity of Na,K-ATPase. Multiple alternatively spliced transcript variants encoding the same protein have been described. Related pseudogenes have been identified on chromosomes 10 and X. Read-through transcripts have been observed between this locus and the downstream sodium/potassium-transporting ATPase subunit gamma (FXYD2, GeneID 486) locus.provided by RefSeq, Feb 2011
Protein Families Ion Channels: Other, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "FXYD6" proteins (13)
SKU Description Size Price
LC411842 Lyophilized FXYD6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC431748 Lyophilized FXYD6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC431749 Lyophilized FXYD6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC431750 Lyophilized FXYD6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC431751 Lyophilized FXYD6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY411842 Transient overexpression lysate of FXYD domain containing ion transport regulator 6 (FXYD6), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY431748 Transient overexpression lysate of FXYD domain containing ion transport regulator 6 (FXYD6), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY431749 Transient overexpression lysate of FXYD domain containing ion transport regulator 6 (FXYD6), transcript variant 4 (as WB positive control) 100 ug
$436.00
LY431750 Transient overexpression lysate of FXYD domain containing ion transport regulator 6 (FXYD6), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY431751 Transient overexpression lysate of FXYD domain containing ion transport regulator 6 (FXYD6), transcript variant 5 (as WB positive control) 100 ug
$436.00
TP310607 Recombinant protein of human FXYD domain containing ion transport regulator 6 (FXYD6), 20 µg 20 ug
$867.00
TP328720 Purified recombinant protein of Homo sapiens FXYD domain containing ion transport regulator 6 (FXYD6), transcript variant 3, 20 µg 20 ug
$867.00
TP328721 Purified recombinant protein of Homo sapiens FXYD domain containing ion transport regulator 6 (FXYD6), transcript variant 4, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products