OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

14-3-3 zeta (YWHAZ) (NM_001135700) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP326999
Purified recombinant protein of Homo sapiens tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide (YWHAZ), transcript variant 4, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA314679 Rabbit polyclonal 14-3-3 zeta (Ser58) antibody(Phospho-specific)
100 ul
$380.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "14-3-3 zeta or NM_001135700"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC226999 representing NM_001135700
Red=Cloning site Green=Tags(s)

MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTE
GAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKG
IVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEES
YKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 27.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001129172
Locus ID 7534
UniProt ID P63104
Cytogenetics 8q22.3
RefSeq ORF 735
Synonyms 14-3-3-zeta; HEL-S-3; HEL-S-93; HEL4; KCIP-1; POPCHAS; YWHAD
Summary This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and sheep orthologs. The encoded protein interacts with IRS1 protein, suggesting a role in regulating insulin sensitivity. Several transcript variants that differ in the 5' UTR but that encode the same protein have been identified for this gene. provided by RefSeq, Oct 2008
Protein Categories Intracellular Proteins
Protein Pathways Cell cycle, Neurotrophin signaling pathway, Oocyte meiosis, Pathogenic Escherichia coli infection
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "14-3-3 zeta" proteins (23)
SKU Description Size Price
PH309909 YWHAZ MS Standard C13 and N15-labeled recombinant protein (NP_003397) 10 ug
$3,360.00
PH326946 YWHAZ MS Standard C13 and N15-labeled recombinant protein (NP_001129171) 10 ug
$3,360.00
PH326999 YWHAZ MS Standard C13 and N15-labeled recombinant protein (NP_001129172) 10 ug
$3,360.00
PH327007 YWHAZ MS Standard C13 and N15-labeled recombinant protein (NP_001129173) 10 ug
$3,360.00
PH327049 YWHAZ MS Standard C13 and N15-labeled recombinant protein (NP_001129174) 10 ug
$3,360.00
LC401160 Lyophilized YWHAZ HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC407895 Lyophilized YWHAZ HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC427673 Lyophilized YWHAZ HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC427674 Lyophilized YWHAZ HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC427675 Lyophilized YWHAZ HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC427676 Lyophilized YWHAZ HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC430139 Lyophilized YWHAZ HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401160 Transient overexpression lysate of tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide (YWHAZ), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY407895 Transient overexpression lysate of tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide (YWHAZ), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY427673 Transient overexpression lysate of tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide (YWHAZ), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY427674 Transient overexpression lysate of tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide (YWHAZ), transcript variant 4 (as WB positive control) 100 ug
$436.00
LY427675 Transient overexpression lysate of tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide (YWHAZ), transcript variant 5 (as WB positive control) 100 ug
$436.00
LY427676 Transient overexpression lysate of tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide (YWHAZ), transcript variant 6 (as WB positive control) 100 ug
$436.00
LY430139 Transient overexpression lysate of tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide (YWHAZ), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP309909 Recombinant protein of human tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide (YWHAZ), transcript variant 1, 20 µg 20 ug
$867.00
TP326946 Purified recombinant protein of Homo sapiens tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide (YWHAZ), transcript variant 3, 20 µg 20 ug
$867.00
TP327007 Purified recombinant protein of Homo sapiens tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide (YWHAZ), transcript variant 5, 20 µg 20 ug
$867.00
TP327049 Purified recombinant protein of Homo sapiens tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide (YWHAZ), transcript variant 6, 20 µg 20 ug
$867.00

file-alt Citations

The proteome of human Fallopian tube lavages during the phase of embryo transit reveals candidate proteins for the optimization of preimplantation embryo culture
Fujii, Yohannes, Por et al
Hum Reprod (2020) 36 (2), 367-380 DOI: 10.1093/humrep/deaa333
Cited by 11
AI Summary: OriGene’s recombinant 14-3-3 zeta protein was used in embryo culture media to assess its effect on murine blastocyst development, helping to evaluate its potential role in optimizing preimplantation embryo culture conditions.
Snippet: … Are there phase-specific changes in the early secretory (ES) phase human tubal lavage proteome that can inform and potentially optimize.;and randomly allocated to culture drops of Continuous Single Culture media (CSC;Irvine Scientific, Santa Ana, CA, USA) with 5 mg/ml of recombinant human serum albumin (rHSA;Novozymes, Bagsvaerd, Denmark) (Morbeck et al., 2014b) and 14-3-3 zeta (Origene, Rockville, MD, USA) at 0.1, 1.0 and 10.0 nM concentrations
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products