OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

14-3-3 zeta (YWHAZ) (NM_003406) Human Mass Spec Standard

Be the first to review this product
SKU
PH309909
YWHAZ MS Standard C13 and N15-labeled recombinant protein (NP_003397)
Size:
10 ug
  $3,360.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA314679 Rabbit polyclonal 14-3-3 zeta (Ser58) antibody(Phospho-specific)
100 ul
$380.00
LY427673 Transient overexpression lysate of tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide (YWHAZ), transcript variant 3 (as WB positive control) 100 ug
$436.00

Other products for "14-3-3 zeta or NM_003406"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC209909
Predicted MW 27.6 kDa
Protein Sequence
Protein Sequence
>RC209909 representing NM_003406
Red=Cloning site Green=Tags(s)

MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTE
GAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKG
IVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEES
YKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003397
RefSeq Size 2834
RefSeq ORF 735
Synonyms 14-3-3-zeta; HEL-S-3; HEL-S-93; HEL4; KCIP-1; POPCHAS; YWHAD
Locus ID 7534
UniProt ID P63104
Cytogenetics 8q22.3
Summary This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and sheep orthologs. The encoded protein interacts with IRS1 protein, suggesting a role in regulating insulin sensitivity. Several transcript variants that differ in the 5' UTR but that encode the same protein have been identified for this gene. provided by RefSeq, Oct 2008
Protein Pathways Cell cycle, Neurotrophin signaling pathway, Oocyte meiosis, Pathogenic Escherichia coli infection
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "14-3-3 zeta" proteins (23)
SKU Description Size Price
PH326946 YWHAZ MS Standard C13 and N15-labeled recombinant protein (NP_001129171) 10 ug
$3,360.00
PH326999 YWHAZ MS Standard C13 and N15-labeled recombinant protein (NP_001129172) 10 ug
$3,360.00
PH327007 YWHAZ MS Standard C13 and N15-labeled recombinant protein (NP_001129173) 10 ug
$3,360.00
PH327049 YWHAZ MS Standard C13 and N15-labeled recombinant protein (NP_001129174) 10 ug
$3,360.00
LC401160 Lyophilized YWHAZ HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC407895 Lyophilized YWHAZ HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC427673 Lyophilized YWHAZ HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC427674 Lyophilized YWHAZ HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC427675 Lyophilized YWHAZ HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC427676 Lyophilized YWHAZ HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC430139 Lyophilized YWHAZ HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401160 Transient overexpression lysate of tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide (YWHAZ), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY407895 Transient overexpression lysate of tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide (YWHAZ), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY427673 Transient overexpression lysate of tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide (YWHAZ), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY427674 Transient overexpression lysate of tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide (YWHAZ), transcript variant 4 (as WB positive control) 100 ug
$436.00
LY427675 Transient overexpression lysate of tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide (YWHAZ), transcript variant 5 (as WB positive control) 100 ug
$436.00
LY427676 Transient overexpression lysate of tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide (YWHAZ), transcript variant 6 (as WB positive control) 100 ug
$436.00
LY430139 Transient overexpression lysate of tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide (YWHAZ), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP309909 Recombinant protein of human tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide (YWHAZ), transcript variant 1, 20 µg 20 ug
$867.00
TP326946 Purified recombinant protein of Homo sapiens tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide (YWHAZ), transcript variant 3, 20 µg 20 ug
$867.00
TP326999 Purified recombinant protein of Homo sapiens tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide (YWHAZ), transcript variant 4, 20 µg 20 ug
$867.00
TP327007 Purified recombinant protein of Homo sapiens tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide (YWHAZ), transcript variant 5, 20 µg 20 ug
$867.00
TP327049 Purified recombinant protein of Homo sapiens tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide (YWHAZ), transcript variant 6, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products