14-3-3 zeta (YWHAZ) (NM_001135702) Human Mass Spec Standard

SKU
PH327049
YWHAZ MS Standard C13 and N15-labeled recombinant protein (NP_001129174)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC227049]
Predicted MW 27.6 kDa
Protein Sequence
Protein Sequence
>RC227049 representing NM_001135702
Red=Cloning site Green=Tags(s)

MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTE
GAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKG
IVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEES
YKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001129174
RefSeq ORF 735
Synonyms 14-3-3-zeta; HEL-S-3; HEL-S-93; HEL4; KCIP-1; POPCHAS; YWHAD
Locus ID 7534
UniProt ID P63104
Cytogenetics 8q22.3
Summary This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and sheep orthologs. The encoded protein interacts with IRS1 protein, suggesting a role in regulating insulin sensitivity. Several transcript variants that differ in the 5' UTR but that encode the same protein have been identified for this gene. [provided by RefSeq, Oct 2008]
Protein Pathways Cell cycle, Neurotrophin signaling pathway, Oocyte meiosis, Pathogenic Escherichia coli infection
Write Your Own Review
You're reviewing:14-3-3 zeta (YWHAZ) (NM_001135702) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH309909 YWHAZ MS Standard C13 and N15-labeled recombinant protein (NP_003397) 10 ug
$3,255.00
PH326946 YWHAZ MS Standard C13 and N15-labeled recombinant protein (NP_001129171) 10 ug
$3,255.00
PH326999 YWHAZ MS Standard C13 and N15-labeled recombinant protein (NP_001129172) 10 ug
$3,255.00
PH327007 YWHAZ MS Standard C13 and N15-labeled recombinant protein (NP_001129173) 10 ug
$3,255.00
LC401160 YWHAZ HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC407895 YWHAZ HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427673 YWHAZ HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427674 YWHAZ HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427675 YWHAZ HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427676 YWHAZ HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC430139 YWHAZ HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401160 Transient overexpression lysate of tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide (YWHAZ), transcript variant 1 100 ug
$436.00
LY407895 Transient overexpression lysate of tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide (YWHAZ), transcript variant 2 100 ug
$436.00
LY427673 Transient overexpression lysate of tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide (YWHAZ), transcript variant 3 100 ug
$436.00
LY427674 Transient overexpression lysate of tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide (YWHAZ), transcript variant 4 100 ug
$436.00
LY427675 Transient overexpression lysate of tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide (YWHAZ), transcript variant 5 100 ug
$436.00
LY427676 Transient overexpression lysate of tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide (YWHAZ), transcript variant 6 100 ug
$436.00
LY430139 Transient overexpression lysate of tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide (YWHAZ), transcript variant 2 100 ug
$436.00
TP309909 Recombinant protein of human tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide (YWHAZ), transcript variant 1, 20 µg 20 ug
$867.00
TP326946 Purified recombinant protein of Homo sapiens tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide (YWHAZ), transcript variant 3, 20 µg 20 ug
$867.00
TP326999 Purified recombinant protein of Homo sapiens tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide (YWHAZ), transcript variant 4, 20 µg 20 ug
$867.00
TP327007 Purified recombinant protein of Homo sapiens tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide (YWHAZ), transcript variant 5, 20 µg 20 ug
$867.00
TP327049 Purified recombinant protein of Homo sapiens tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide (YWHAZ), transcript variant 6, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.