OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

LANCL1 (NM_001136575) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP326718
Recombinant protein of human LanC lantibiotic synthetase component C-like 1 (bacterial) (LANCL1), transcript variant 3, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA358900 LANCL1 Antibody - N-terminal region
100 ul
$585.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "LANCL1 or NM_001136575"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC226718 protein sequence
Red=Cloning site Green=Tags(s)

MAQRAFPNPYADYNKSLAEGYFDAAGRLTPEFSQRLTNKIRELLQQMERGLKSADPRDGTGYTGWAGIAV
LYLHLYDVFGDPAYLQLAHGYVKQSLNCLTKRSITFLCGDAGPLAVAAVLYHKMNNEKQAEDCITRLIHL
NKIDPHAPNEMLYGRIGYIYALLFVNKNFGVEKIPQSHIQQICETILTSGENLARKRNFTAKSPLMYEWY
QEYYVGAAHGLAGIYYYLMQPSLQVSQGKLHSLVKPSVDYVCQLKFPSGNYPPCIGDNRDLLVHWCHGAP
GVIYMLIQAYKVFREEKYLCDAYQCADVIWQYGLLKKGYGLCHGSAGNAYAFLTLYNLTQDMKYLYRACK
FAEWCLEYGEHGCRTPDTPFSLFEGMAGTIYFLADLLVPTKARFPAFEL

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 45.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001130047
Locus ID 10314
UniProt ID O43813
Cytogenetics 2q34
RefSeq Size 4526
RefSeq ORF 1197
Synonyms GPR69A; p40
Summary This gene encodes a loosely associated peripheral membrane protein related to the LanC family of bacterial membrane-associated proteins involved in the biosynthesis of antimicrobial peptides. This protein may play a role as a peptide-modifying enzyme component in eukaryotic cells. Previously considered a member of the G-protein-coupled receptor superfamily, this protein is now in the LanC family. Multiple alternatively spliced variants, encoding the same protein, have been identified. provided by RefSeq, Nov 2008
Protein Categories Intracellular Proteins
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "LANCL1" proteins (11)
SKU Description Size Price
PH305279 LANCL1 MS Standard C13 and N15-labeled recombinant protein (NP_006046) 10 ug
$3,360.00
PH326718 LANCL1 MS Standard C13 and N15-labeled recombinant protein (NP_001130047) 10 ug
$3,360.00
PH327716 LANCL1 MS Standard C13 and N15-labeled recombinant protein (NP_001130046) 10 ug
$3,360.00
LC401823 Lyophilized LANCL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC427929 Lyophilized LANCL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC427930 Lyophilized LANCL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401823 Transient overexpression lysate of LanC lantibiotic synthetase component C-like 1 (bacterial) (LANCL1), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY427929 Transient overexpression lysate of LanC lantibiotic synthetase component C-like 1 (bacterial) (LANCL1), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY427930 Transient overexpression lysate of LanC lantibiotic synthetase component C-like 1 (bacterial) (LANCL1), transcript variant 3 (as WB positive control) 100 ug
$436.00
TP305279 Recombinant protein of human LanC lantibiotic synthetase component C-like 1 (bacterial) (LANCL1), transcript variant 1, 20 µg 20 ug
$867.00
TP327716 Recombinant protein of human LanC lantibiotic synthetase component C-like 1 (bacterial) (LANCL1), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products