LANCL1 (NM_001136574) Human Mass Spec Standard

SKU
PH327716
LANCL1 MS Standard C13 and N15-labeled recombinant protein (NP_001130046)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC227716]
Predicted MW 45.3 kDa
Protein Sequence
Protein Sequence
>RC227716 protein sequence
Red=Cloning site Green=Tags(s)

MAQRAFPNPYADYNKSLAEGYFDAAGRLTPEFSQRLTNKIRELLQQMERGLKSADPRDGTGYTGWAGIAV
LYLHLYDVFGDPAYLQLAHGYVKQSLNCLTKRSITFLCGDAGPLAVAAVLYHKMNNEKQAEDCITRLIHL
NKIDPHAPNEMLYGRIGYIYALLFVNKNFGVEKIPQSHIQQICETILTSGENLARKRNFTAKSPLMYEWY
QEYYVGAAHGLAGIYYYLMQPSLQVSQGKLHSLVKPSVDYVCQLKFPSGNYPPCIGDNRDLLVHWCHGAP
GVIYMLIQAYKVFREEKYLCDAYQCADVIWQYGLLKKGYGLCHGSAGNAYAFLTLYNLTQDMKYLYRACK
FAEWCLEYGEHGCRTPDTPFSLFEGMAGTIYFLADLLVPTKARFPAFEL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001130046
RefSeq Size 4531
RefSeq ORF 1197
Synonyms GPR69A; p40
Locus ID 10314
UniProt ID O43813
Cytogenetics 2q34
Summary This gene encodes a loosely associated peripheral membrane protein related to the LanC family of bacterial membrane-associated proteins involved in the biosynthesis of antimicrobial peptides. This protein may play a role as a peptide-modifying enzyme component in eukaryotic cells. Previously considered a member of the G-protein-coupled receptor superfamily, this protein is now in the LanC family. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Nov 2008]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:LANCL1 (NM_001136574) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH305279 LANCL1 MS Standard C13 and N15-labeled recombinant protein (NP_006046) 10 ug
$3,255.00
PH326718 LANCL1 MS Standard C13 and N15-labeled recombinant protein (NP_001130047) 10 ug
$3,255.00
LC401823 LANCL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427929 LANCL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427930 LANCL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401823 Transient overexpression lysate of LanC lantibiotic synthetase component C-like 1 (bacterial) (LANCL1), transcript variant 1 100 ug
$436.00
LY427929 Transient overexpression lysate of LanC lantibiotic synthetase component C-like 1 (bacterial) (LANCL1), transcript variant 2 100 ug
$436.00
LY427930 Transient overexpression lysate of LanC lantibiotic synthetase component C-like 1 (bacterial) (LANCL1), transcript variant 3 100 ug
$436.00
TP305279 Recombinant protein of human LanC lantibiotic synthetase component C-like 1 (bacterial) (LANCL1), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP326718 Recombinant protein of human LanC lantibiotic synthetase component C-like 1 (bacterial) (LANCL1), transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP327716 Recombinant protein of human LanC lantibiotic synthetase component C-like 1 (bacterial) (LANCL1), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.