LANCL1 (NM_006055) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC205279] |
Predicted MW | 45.3 kDa |
Protein Sequence |
Protein Sequence
>RC205279 protein sequence
Red=Cloning site Green=Tags(s) MAQRAFPNPYADYNKSLAEGYFDAAGRLTPEFSQRLTNKIRELLQQMERGLKSADPRDGTGYTGWAGIAV LYLHLYDVFGDPAYLQLAHGYVKQSLNCLTKRSITFLCGDAGPLAVAAVLYHKMNNEKQAEDCITRLIHL NKIDPHAPNEMLYGRIGYIYALLFVNKNFGVEKIPQSHIQQICETILTSGENLARKRNFTAKSPLMYEWY QEYYVGAAHGLAGIYYYLMQPSLQVSQGKLHSLVKPSVDYVCQLKFPSGNYPPCIGDNRDLLVHWCHGAP GVIYMLIQAYKVFREEKYLCDAYQCADVIWQYGLLKKGYGLCHGSAGNAYAFLTLYNLTQDMKYLYRACK FAEWCLEYGEHGCRTPDTPFSLFEGMAGTIYFLADLLVPTKARFPAFEL myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_006046 |
RefSeq Size | 4620 |
RefSeq ORF | 1197 |
Synonyms | GPR69A; p40 |
Locus ID | 10314 |
UniProt ID | O43813 |
Cytogenetics | 2q34 |
Summary | This gene encodes a loosely associated peripheral membrane protein related to the LanC family of bacterial membrane-associated proteins involved in the biosynthesis of antimicrobial peptides. This protein may play a role as a peptide-modifying enzyme component in eukaryotic cells. Previously considered a member of the G-protein-coupled receptor superfamily, this protein is now in the LanC family. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Nov 2008] |
Protein Families | Druggable Genome |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH326718 | LANCL1 MS Standard C13 and N15-labeled recombinant protein (NP_001130047) | 10 ug |
$3,255.00
|
|
PH327716 | LANCL1 MS Standard C13 and N15-labeled recombinant protein (NP_001130046) | 10 ug |
$3,255.00
|
|
LC401823 | LANCL1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC427929 | LANCL1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC427930 | LANCL1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY401823 | Transient overexpression lysate of LanC lantibiotic synthetase component C-like 1 (bacterial) (LANCL1), transcript variant 1 | 100 ug |
$436.00
|
|
LY427929 | Transient overexpression lysate of LanC lantibiotic synthetase component C-like 1 (bacterial) (LANCL1), transcript variant 2 | 100 ug |
$436.00
|
|
LY427930 | Transient overexpression lysate of LanC lantibiotic synthetase component C-like 1 (bacterial) (LANCL1), transcript variant 3 | 100 ug |
$436.00
|
|
TP305279 | Recombinant protein of human LanC lantibiotic synthetase component C-like 1 (bacterial) (LANCL1), transcript variant 1, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP326718 | Recombinant protein of human LanC lantibiotic synthetase component C-like 1 (bacterial) (LANCL1), transcript variant 3, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP327716 | Recombinant protein of human LanC lantibiotic synthetase component C-like 1 (bacterial) (LANCL1), transcript variant 2, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.