OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CD71 (TFRC) (NM_001128148) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP326147
Recombinant protein of human transferrin receptor (p90, CD71) (TFRC), 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA803640 TFRC mouse monoclonal antibody,clone OTI6H9 100 ul
$447.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "CD71 or NM_001128148"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC226147 representing NM_001128148
Red=Cloning site Green=Tags(s)

MMDQARSAFSNLFGGEPLSYTRFSLARQVDGDNSHVEMKLAVDEEENADNNTKANVTKPKRCSGSICYGT
IAVIVFFLIGFMIGYLGYCKGVEPKTECERLAGTESPVREEPGEDFPAARRLYWDDLKRKLSEKLDSTDF
TGTIKLLNENSYVPREAGSQKDENLALYVENQFREFKLSKVWRDQHFVKIQVKDSAQNSVIIVDKNGRLV
YLVENPGGYVAYSKAATVTGKLVHANFGTKKDFEDLYTPVNGSIVIVRAGKITFAEKVANAESLNAIGVL
IYMDQTKFPIVNAELSFFGHAHLGTGDPYTPGFPSFNHTQFPPSRSSGLPNIPVQTISRAAAEKLFGNME
GDCPSDWKTDSTCRMVTSESKNVKLTVSNVLKEIKILNIFGVIKGFVEPDHYVVVGAQRDAWGPGAAKSG
VGTALLLKLAQMFSDMVLKDGFQPSRSIIFASWSAGDFGSVGATEWLEGYLSSLHLKAFTYINLDKAVLG
TSNFKVSASPLLYTLIEKTMQNVKHPVTGQFLYQDSNWASKVEKLTLDNAAFPFLAYSGIPAVSFCFCED
TDYPYLGTTMDTYKELIERIPELNKVARAAAEVAGQFVIKLTHDVELNLDYERYNSQLLSFVRDLNQYRA
DIKEMGLSLQWLYSARGDFFRATSRLTTDFGNAEKTDRFVMKKLNDRVMRVEYHFLSPYVSPKESPFRHV
FWGSGSHTLPALLENLKLRKQNNGAFNETLFRNQLALATWTIQGAANALSGDVWDIDNEF

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 84.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001121620
Locus ID 7037
UniProt ID P02786
Cytogenetics 3q29
RefSeq ORF 2280
Synonyms CD71; IMD46; p90; T9; TFR; TFR1; TR; TRFR
Summary This gene encodes a cell surface receptor necessary for cellular iron uptake by the process of receptor-mediated endocytosis. This receptor is required for erythropoiesis and neurologic development. Multiple alternatively spliced variants have been identified. provided by RefSeq, Sep 2015
Protein Categories ADC Targets, CD Markers, Enzyme: Peptidases, Immune system diseases, Intracellular Proteins, Membrane Proteins, Secreated Proteins
Protein Families Druggable Genome, ES Cell Differentiation/IPS, Protease, Secreted Protein, Transmembrane
Protein Pathways Endocytosis, Hematopoietic cell lineage
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CD71" proteins (7)
SKU Description Size Price
PH300980 TFRC MS Standard C13 and N15-labeled recombinant protein (NP_003225) 10 ug
$3,360.00
PH326147 TFRC MS Standard C13 and N15-labeled recombinant protein (NP_001121620) 10 ug
$3,360.00
LC418818 Lyophilized TFRC HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC426898 Lyophilized TFRC HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY418818 Transient overexpression lysate of transferrin receptor (p90, CD71) (TFRC) (as WB positive control) 100 ug
$436.00
LY426898 Transient overexpression lysate of transferrin receptor (p90, CD71) (TFRC) (as WB positive control) 100 ug
$665.00
TP300980 Recombinant protein of human transferrin receptor (p90, CD71) (TFRC), 20 µg 20 ug
$867.00

file-alt Citations

Leucine zipper transcription factor-like 1 binds adaptor protein complex-1 and 2 and participates in trafficking of transferrin receptor 1
Promchan, Natarajan
PLoS ONE (2020) 15 (1), e0226298 DOI: 10.1371/journal.pone.0226298
Cited by 13
AI Summary: OriGene products contributed to this study by providing plasmids expressing human LZTFL1 (NM_020347) and TfR1 (NM_003234) with Myc-FLAG tags in the pCMV6-Entry vector, which were used to investigate the interactions and trafficking mechanisms involving these proteins.
Snippet: Materials and methods Plasmids and antibodies Plasmids expressing human LZTFL1 (NM_020347) and TfR1 (NM_003234) with Myc-FLAG tag in pCMV6-Entry vector were purchased from OriGene Technologies (Rockville, MD);;- Materials and methods Plasmids and antibodies Plasmids expressing human LZTFL1 (NM_020347) and TfR1 (NM_003234) with Myc-FLAG tag in pCMV6-Entry vector were purchased from OriGene Technologies (Rockville, MD)
FigureFigureFigure
IP
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products