CD71 (TFRC) (NM_003234) Human Recombinant Protein

SKU
TP300980
Recombinant protein of human transferrin receptor (p90, CD71) (TFRC), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC200980 representing NM_003234
Red=Cloning site Green=Tags(s)

MMDQARSAFSNLFGGEPLSYTRFSLARQVDGDNSHVEMKLAVDEEENADNNTKANVTKPKRCSGSICYGT
IAVIVFFLIGFMIGYLGYCKGVEPKTECERLAGTESPVREEPGEDFPAARRLYWDDLKRKLSEKLDSTDF
TGTIKLLNENSYVPREAGSQKDENLALYVENQFREFKLSKVWRDQHFVKIQVKDSAQNSVIIVDKNGRLV
YLVENPGGYVAYSKAATVTGKLVHANFGTKKDFEDLYTPVNGSIVIVRAGKITFAEKVANAESLNAIGVL
IYMDQTKFPIVNAELSFFGHAHLGTGDPYTPGFPSFNHTQFPPSRSSGLPNIPVQTISRAAAEKLFGNME
GDCPSDWKTDSTCRMVTSESKNVKLTVSNVLKEIKILNIFGVIKGFVEPDHYVVVGAQRDAWGPGAAKSG
VGTALLLKLAQMFSDMVLKDGFQPSRSIIFASWSAGDFGSVGATEWLEGYLSSLHLKAFTYINLDKAVLG
TSNFKVSASPLLYTLIEKTMQNVKHPVTGQFLYQDSNWASKVEKLTLDNAAFPFLAYSGIPAVSFCFCED
TDYPYLGTTMDTYKELIERIPELNKVARAAAEVAGQFVIKLTHDVELNLDYERYNSQLLSFVRDLNQYRA
DIKEMGLSLQWLYSARGDFFRATSRLTTDFGNAEKTDRFVMKKLNDRVMRVEYHFLSPYVSPKESPFRHV
FWGSGSHTLPALLENLKLRKQNNGAFNETLFRNQLALATWTIQGAANALSGDVWDIDNEF

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 84.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_003225
Locus ID 7037
UniProt ID P02786
Cytogenetics 3q29
RefSeq Size 5010
RefSeq ORF 2280
Synonyms CD71; IMD46; p90; T9; TFR; TFR1; TR; TRFR
Summary This gene encodes a cell surface receptor necessary for cellular iron uptake by the process of receptor-mediated endocytosis. This receptor is required for erythropoiesis and neurologic development. Multiple alternatively spliced variants have been identified. [provided by RefSeq, Sep 2015]
Protein Families Druggable Genome, ES Cell Differentiation/IPS, Protease, Secreted Protein, Transmembrane
Protein Pathways Endocytosis, Hematopoietic cell lineage
Write Your Own Review
You're reviewing:CD71 (TFRC) (NM_003234) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH300980 TFRC MS Standard C13 and N15-labeled recombinant protein (NP_003225) 10 ug
$3,255.00
PH326147 TFRC MS Standard C13 and N15-labeled recombinant protein (NP_001121620) 10 ug
$3,255.00
LC418818 TFRC HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC426898 TFRC HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY418818 Transient overexpression lysate of transferrin receptor (p90, CD71) (TFRC) 100 ug
$436.00
LY426898 Transient overexpression lysate of transferrin receptor (p90, CD71) (TFRC) 100 ug
$665.00
TP326147 Recombinant protein of human transferrin receptor (p90, CD71) (TFRC), 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.