CD71 (TFRC) (NM_003234) Human Mass Spec Standard

SKU
PH300980
TFRC MS Standard C13 and N15-labeled recombinant protein (NP_003225)
$3,255.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC200980]
Predicted MW 84.7 kDa
Protein Sequence
Protein Sequence
>RC200980 representing NM_003234
Red=Cloning site Green=Tags(s)

MMDQARSAFSNLFGGEPLSYTRFSLARQVDGDNSHVEMKLAVDEEENADNNTKANVTKPKRCSGSICYGT
IAVIVFFLIGFMIGYLGYCKGVEPKTECERLAGTESPVREEPGEDFPAARRLYWDDLKRKLSEKLDSTDF
TGTIKLLNENSYVPREAGSQKDENLALYVENQFREFKLSKVWRDQHFVKIQVKDSAQNSVIIVDKNGRLV
YLVENPGGYVAYSKAATVTGKLVHANFGTKKDFEDLYTPVNGSIVIVRAGKITFAEKVANAESLNAIGVL
IYMDQTKFPIVNAELSFFGHAHLGTGDPYTPGFPSFNHTQFPPSRSSGLPNIPVQTISRAAAEKLFGNME
GDCPSDWKTDSTCRMVTSESKNVKLTVSNVLKEIKILNIFGVIKGFVEPDHYVVVGAQRDAWGPGAAKSG
VGTALLLKLAQMFSDMVLKDGFQPSRSIIFASWSAGDFGSVGATEWLEGYLSSLHLKAFTYINLDKAVLG
TSNFKVSASPLLYTLIEKTMQNVKHPVTGQFLYQDSNWASKVEKLTLDNAAFPFLAYSGIPAVSFCFCED
TDYPYLGTTMDTYKELIERIPELNKVARAAAEVAGQFVIKLTHDVELNLDYERYNSQLLSFVRDLNQYRA
DIKEMGLSLQWLYSARGDFFRATSRLTTDFGNAEKTDRFVMKKLNDRVMRVEYHFLSPYVSPKESPFRHV
FWGSGSHTLPALLENLKLRKQNNGAFNETLFRNQLALATWTIQGAANALSGDVWDIDNEF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003225
RefSeq Size 5010
RefSeq ORF 2280
Synonyms CD71; IMD46; p90; T9; TFR; TFR1; TR; TRFR
Locus ID 7037
UniProt ID P02786
Cytogenetics 3q29
Summary This gene encodes a cell surface receptor necessary for cellular iron uptake by the process of receptor-mediated endocytosis. This receptor is required for erythropoiesis and neurologic development. Multiple alternatively spliced variants have been identified. [provided by RefSeq, Sep 2015]
Protein Families Druggable Genome, ES Cell Differentiation/IPS, Protease, Secreted Protein, Transmembrane
Protein Pathways Endocytosis, Hematopoietic cell lineage
Write Your Own Review
You're reviewing:CD71 (TFRC) (NM_003234) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH326147 TFRC MS Standard C13 and N15-labeled recombinant protein (NP_001121620) 10 ug
$3,255.00
LC418818 TFRC HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC426898 TFRC HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY418818 Transient overexpression lysate of transferrin receptor (p90, CD71) (TFRC) 100 ug
$436.00
LY426898 Transient overexpression lysate of transferrin receptor (p90, CD71) (TFRC) 100 ug
$665.00
TP300980 Recombinant protein of human transferrin receptor (p90, CD71) (TFRC), 20 µg 20 ug
$867.00
TP326147 Recombinant protein of human transferrin receptor (p90, CD71) (TFRC), 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.