OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CD71 (TFRC) (NM_003234) Human Mass Spec Standard

Be the first to review this product
SKU
PH300980
TFRC MS Standard C13 and N15-labeled recombinant protein (NP_003225)
Size:
10 ug
  $3,360.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA803640 TFRC mouse monoclonal antibody,clone OTI6H9 100 ul
$447.00
LY418818 Transient overexpression lysate of transferrin receptor (p90, CD71) (TFRC) (as WB positive control) 100 ug
$436.00

Other products for "CD71 or NM_003234"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200980
Predicted MW 84.7 kDa
Protein Sequence
Protein Sequence
>RC200980 representing NM_003234
Red=Cloning site Green=Tags(s)

MMDQARSAFSNLFGGEPLSYTRFSLARQVDGDNSHVEMKLAVDEEENADNNTKANVTKPKRCSGSICYGT
IAVIVFFLIGFMIGYLGYCKGVEPKTECERLAGTESPVREEPGEDFPAARRLYWDDLKRKLSEKLDSTDF
TGTIKLLNENSYVPREAGSQKDENLALYVENQFREFKLSKVWRDQHFVKIQVKDSAQNSVIIVDKNGRLV
YLVENPGGYVAYSKAATVTGKLVHANFGTKKDFEDLYTPVNGSIVIVRAGKITFAEKVANAESLNAIGVL
IYMDQTKFPIVNAELSFFGHAHLGTGDPYTPGFPSFNHTQFPPSRSSGLPNIPVQTISRAAAEKLFGNME
GDCPSDWKTDSTCRMVTSESKNVKLTVSNVLKEIKILNIFGVIKGFVEPDHYVVVGAQRDAWGPGAAKSG
VGTALLLKLAQMFSDMVLKDGFQPSRSIIFASWSAGDFGSVGATEWLEGYLSSLHLKAFTYINLDKAVLG
TSNFKVSASPLLYTLIEKTMQNVKHPVTGQFLYQDSNWASKVEKLTLDNAAFPFLAYSGIPAVSFCFCED
TDYPYLGTTMDTYKELIERIPELNKVARAAAEVAGQFVIKLTHDVELNLDYERYNSQLLSFVRDLNQYRA
DIKEMGLSLQWLYSARGDFFRATSRLTTDFGNAEKTDRFVMKKLNDRVMRVEYHFLSPYVSPKESPFRHV
FWGSGSHTLPALLENLKLRKQNNGAFNETLFRNQLALATWTIQGAANALSGDVWDIDNEF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003225
RefSeq Size 5010
RefSeq ORF 2280
Synonyms CD71; IMD46; p90; T9; TFR; TFR1; TR; TRFR
Locus ID 7037
UniProt ID P02786
Cytogenetics 3q29
Summary This gene encodes a cell surface receptor necessary for cellular iron uptake by the process of receptor-mediated endocytosis. This receptor is required for erythropoiesis and neurologic development. Multiple alternatively spliced variants have been identified. provided by RefSeq, Sep 2015
Protein Families Druggable Genome, ES Cell Differentiation/IPS, Protease, Secreted Protein, Transmembrane
Protein Pathways Endocytosis, Hematopoietic cell lineage
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CD71" proteins (7)
SKU Description Size Price
PH326147 TFRC MS Standard C13 and N15-labeled recombinant protein (NP_001121620) 10 ug
$3,360.00
LC418818 Lyophilized TFRC HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC426898 Lyophilized TFRC HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY418818 Transient overexpression lysate of transferrin receptor (p90, CD71) (TFRC) (as WB positive control) 100 ug
$436.00
LY426898 Transient overexpression lysate of transferrin receptor (p90, CD71) (TFRC) (as WB positive control) 100 ug
$665.00
TP300980 Recombinant protein of human transferrin receptor (p90, CD71) (TFRC), 20 µg 20 ug
$867.00
TP326147 Recombinant protein of human transferrin receptor (p90, CD71) (TFRC), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products