OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

C4BPB (NM_000716) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP323685
Recombinant protein of human complement component 4 binding protein, beta (C4BPB), transcript variant 1, 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA334285 Rabbit Polyclonal Anti-C4BPB Antibody
100 ul
$585.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "C4BPB or NM_000716"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC223685 representing NM_000716
Red=Cloning site Green=Tags(s)

MFFWCACCLMVAWRVSASDEHCPELPPVDNSIFVAKEVEGQILGTYVCIKGYHLVGKKTLFCNASKEWDN
TTTECRLGHCPDPVLVNGEFSSSGPVNVSDKITFMCNDHYILKGSNRSQCLEDHTWAPPFPICKSRDCDP
PGNPVHGYFEGNNFTLGSTISYYCEDRYYLVGVQEQQCVDGEWSSALPVCKLIQEAPKPECEKALLAFQE
SKNLCEAMENFMQQLKESGMTMEELKYSLELKKAELKAKLL

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 26.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_000707
Locus ID 725
UniProt ID P20851
Cytogenetics 1q32.1
RefSeq Size 1131
RefSeq ORF 753
Synonyms C4BP
Summary This gene encodes a member of a superfamily of proteins composed predominantly of tandemly arrayed short consensus repeats of approximately 60 amino acids. A single, unique beta-chain encoded by this gene assembles with seven identical alpha-chains into the predominant isoform of C4b-binding protein, a multimeric protein that controls activation of the complement cascade through the classical pathway. C4b-binding protein has a regulatory role in the coagulation system also, mediated through the beta-chain binding of protein S, a vitamin K-dependent protein that serves as a cofactor of activated protein C. The genes encoding both alpha and beta chains are located adjacent to each other on human chromosome 1 in the regulator of complement activation gene cluster. Alternative splicing gives rise to multiple transcript variants. provided by RefSeq, Jul 2008
Protein Categories Immune system diseases, Secreated Proteins
Protein Pathways Complement and coagulation cascades
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "C4BPB" proteins (15)
SKU Description Size Price
PH302799 C4BPB MS Standard C13 and N15-labeled recombinant protein (NP_001017365) 10 ug
$3,360.00
PH319158 C4BPB MS Standard C13 and N15-labeled recombinant protein (NP_001017364) 10 ug
$3,360.00
PH319216 C4BPB MS Standard C13 and N15-labeled recombinant protein (NP_001017367) 10 ug
$3,360.00
PH323685 C4BPB MS Standard C13 and N15-labeled recombinant protein (NP_000707) 10 ug
$3,360.00
LC422638 Lyophilized C4BPB HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422639 Lyophilized C4BPB HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422641 Lyophilized C4BPB HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC424545 Lyophilized C4BPB HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY422638 Transient overexpression lysate of complement component 4 binding protein, beta (C4BPB), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY422639 Transient overexpression lysate of complement component 4 binding protein, beta (C4BPB), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY422641 Transient overexpression lysate of complement component 4 binding protein, beta (C4BPB), transcript variant 5 (as WB positive control) 100 ug
$436.00
LY424545 Transient overexpression lysate of complement component 4 binding protein, beta (C4BPB), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP302799 Recombinant protein of human complement component 4 binding protein, beta (C4BPB), transcript variant 3, 20 µg 20 ug
$737.00
TP319158 Recombinant protein of human complement component 4 binding protein, beta (C4BPB), transcript variant 2, 20 µg 20 ug
$737.00
TP319216 Purified recombinant protein of Homo sapiens complement component 4 binding protein, beta (C4BPB), transcript variant 5, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products