C4BPB (NM_001017365) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC202799] |
Predicted MW | 28.3 kDa |
Protein Sequence |
Protein Sequence
>RC202799 protein sequence
Red=Cloning site Green=Tags(s) MFFWCACCLMVAWRVSASDEHCPELPPVDNSIFVAKEVEGQILGTYVCIKGYHLVGKKTLFCNASKEWDN TTTECRLGHCPDPVLVNGEFSSSGPVNVSDKITFMCNDHYILKGSNRSQCLEDHTWAPPFPICKSRDCDP PGNPVHGYFEGNNFTLGSTISYYCEDRYYLVGVQEQQCVDGEWSSALPVCKLIQEAPKPECEKALLAFQE SKNLCEAMENFMQQLKESGMTMEELKYSLELKKAELKAKLL myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_001017365 |
RefSeq Size | 968 |
RefSeq ORF | 753 |
Synonyms | C4BP |
Locus ID | 725 |
UniProt ID | P20851 |
Cytogenetics | 1q32.1 |
Summary | This gene encodes a member of a superfamily of proteins composed predominantly of tandemly arrayed short consensus repeats of approximately 60 amino acids. A single, unique beta-chain encoded by this gene assembles with seven identical alpha-chains into the predominant isoform of C4b-binding protein, a multimeric protein that controls activation of the complement cascade through the classical pathway. C4b-binding protein has a regulatory role in the coagulation system also, mediated through the beta-chain binding of protein S, a vitamin K-dependent protein that serves as a cofactor of activated protein C. The genes encoding both alpha and beta chains are located adjacent to each other on human chromosome 1 in the regulator of complement activation gene cluster. Alternative splicing gives rise to multiple transcript variants. [provided by RefSeq, Jul 2008] |
Protein Pathways | Complement and coagulation cascades |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH319158 | C4BPB MS Standard C13 and N15-labeled recombinant protein (NP_001017364) | 10 ug |
$3,255.00
|
|
PH319216 | C4BPB MS Standard C13 and N15-labeled recombinant protein (NP_001017367) | 10 ug |
$3,255.00
|
|
PH323685 | C4BPB MS Standard C13 and N15-labeled recombinant protein (NP_000707) | 10 ug |
$3,255.00
|
|
LC422638 | C4BPB HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC422639 | C4BPB HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC422641 | C4BPB HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC424545 | C4BPB HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY422638 | Transient overexpression lysate of complement component 4 binding protein, beta (C4BPB), transcript variant 2 | 100 ug |
$436.00
|
|
LY422639 | Transient overexpression lysate of complement component 4 binding protein, beta (C4BPB), transcript variant 3 | 100 ug |
$436.00
|
|
LY422641 | Transient overexpression lysate of complement component 4 binding protein, beta (C4BPB), transcript variant 5 | 100 ug |
$436.00
|
|
LY424545 | Transient overexpression lysate of complement component 4 binding protein, beta (C4BPB), transcript variant 1 | 100 ug |
$436.00
|
|
TP302799 | Recombinant protein of human complement component 4 binding protein, beta (C4BPB), transcript variant 3, 20 µg | 20 ug |
$737.00
|
|
TP319158 | Recombinant protein of human complement component 4 binding protein, beta (C4BPB), transcript variant 2, 20 µg | 20 ug |
$737.00
|
|
TP319216 | Purified recombinant protein of Homo sapiens complement component 4 binding protein, beta (C4BPB), transcript variant 5, 20 µg | 20 ug |
$737.00
|
|
TP323685 | Recombinant protein of human complement component 4 binding protein, beta (C4BPB), transcript variant 1, 20 µg | 20 ug |
$737.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.