C4BPB (NM_000716) Human Mass Spec Standard

SKU
PH323685
C4BPB MS Standard C13 and N15-labeled recombinant protein (NP_000707)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC223685]
Predicted MW 28.29 kDa
Protein Sequence
Protein Sequence
>RC223685 representing NM_000716
Red=Cloning site Green=Tags(s)

MFFWCACCLMVAWRVSASDEHCPELPPVDNSIFVAKEVEGQILGTYVCIKGYHLVGKKTLFCNASKEWDN
TTTECRLGHCPDPVLVNGEFSSSGPVNVSDKITFMCNDHYILKGSNRSQCLEDHTWAPPFPICKSRDCDP
PGNPVHGYFEGNNFTLGSTISYYCEDRYYLVGVQEQQCVDGEWSSALPVCKLIQEAPKPECEKALLAFQE
SKNLCEAMENFMQQLKESGMTMEELKYSLELKKAELKAKLL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_000707
RefSeq Size 1131
RefSeq ORF 753
Synonyms C4BP
Locus ID 725
UniProt ID P20851
Cytogenetics 1q32.1
Summary This gene encodes a member of a superfamily of proteins composed predominantly of tandemly arrayed short consensus repeats of approximately 60 amino acids. A single, unique beta-chain encoded by this gene assembles with seven identical alpha-chains into the predominant isoform of C4b-binding protein, a multimeric protein that controls activation of the complement cascade through the classical pathway. C4b-binding protein has a regulatory role in the coagulation system also, mediated through the beta-chain binding of protein S, a vitamin K-dependent protein that serves as a cofactor of activated protein C. The genes encoding both alpha and beta chains are located adjacent to each other on human chromosome 1 in the regulator of complement activation gene cluster. Alternative splicing gives rise to multiple transcript variants. [provided by RefSeq, Jul 2008]
Protein Pathways Complement and coagulation cascades
Write Your Own Review
You're reviewing:C4BPB (NM_000716) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH302799 C4BPB MS Standard C13 and N15-labeled recombinant protein (NP_001017365) 10 ug
$3,255.00
PH319158 C4BPB MS Standard C13 and N15-labeled recombinant protein (NP_001017364) 10 ug
$3,255.00
PH319216 C4BPB MS Standard C13 and N15-labeled recombinant protein (NP_001017367) 10 ug
$3,255.00
LC422638 C4BPB HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422639 C4BPB HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422641 C4BPB HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC424545 C4BPB HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY422638 Transient overexpression lysate of complement component 4 binding protein, beta (C4BPB), transcript variant 2 100 ug
$436.00
LY422639 Transient overexpression lysate of complement component 4 binding protein, beta (C4BPB), transcript variant 3 100 ug
$436.00
LY422641 Transient overexpression lysate of complement component 4 binding protein, beta (C4BPB), transcript variant 5 100 ug
$436.00
LY424545 Transient overexpression lysate of complement component 4 binding protein, beta (C4BPB), transcript variant 1 100 ug
$436.00
TP302799 Recombinant protein of human complement component 4 binding protein, beta (C4BPB), transcript variant 3, 20 µg 20 ug
$737.00
TP319158 Recombinant protein of human complement component 4 binding protein, beta (C4BPB), transcript variant 2, 20 µg 20 ug
$737.00
TP319216 Purified recombinant protein of Homo sapiens complement component 4 binding protein, beta (C4BPB), transcript variant 5, 20 µg 20 ug
$737.00
TP323685 Recombinant protein of human complement component 4 binding protein, beta (C4BPB), transcript variant 1, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.