C1QL3 (NM_001010908) Human Recombinant Protein

CAT#: TP323500

Purified recombinant protein of Homo sapiens complement component 1, q subcomponent-like 3 (C1QL3), 20 µg

Product Images

Coomassie blue staining of purified C1QL3 protein (Cat# TP323500). The protein was produced from HEK293T cells transfected with C1QL3 cDNA clone (Cat# RC223500) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC223500 representing NM_001010908
  Red=Cloning site Green=Tags(s)
  
  MVLLLVILIPVLVSSAGTSAHYEMLGTCRMVCDPYGGTKAPSTAATPDRGLMQSLPTFIQGPKGEAGRPG
  KAGPRGPPGEPGPPGPMGPPGEKGEPGRQGLPGPPGAPGLNAAGAISAATYSTVPKIAFYAGLKRQHEGY
  EVLKFDDVVTNLGNHYDPTTGKFTCSIPGIYFFTYHVLMRGGDGTSMWADLCKNNQVRASAIAQDADQNY
  DYASNSVVLHLEPGDEVYIKLDGGKAHGGNNNKYSTFSGFIIYAD
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 26.5 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001010908
• Locus ID: 389941
• UniProt ID: Q5VWW1, A0A3B0J0F3
• Cytogenetics: 10p13
• Refseq Size: 2493
• Refseq ORF: 765
• Synonyms: C1ql; C1QTNF13; CTRP13; K100
• Summary: May regulate the number of excitatory synapses that are formed on hippocampus neurons. Has no effect on inhibitory synapses (By similarity). Plays a role in glucose homeostasis. Via AMPK signaling pathway, stimulates glucose uptake in adipocytes, myotubes and hepatocytes and enhances insulin-stimulated glucose uptake. In a hepatoma cell line, reduces the expression of gluconeogenic enzymes G6PC and PCK1 and hence decreases de novo glucose production (By similarity).[UniProtKB/Swiss-Prot Function]
• Protein Families: Secreted Protein