OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

C1QL3 (NM_001010908) Human Mass Spec Standard

Be the first to review this product
SKU
PH323500
C1QL3 MS Standard C13 and N15-labeled recombinant protein (NP_001010908)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA358995 C1QL3 Antibody - middle region
100 ul
$585.00

Other products for "C1QL3 or NM_001010908"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC223500
Predicted MW 26.5 kDa
Protein Sequence
Protein Sequence
>RC223500 representing NM_001010908
Red=Cloning site Green=Tags(s)

MVLLLVILIPVLVSSAGTSAHYEMLGTCRMVCDPYGGTKAPSTAATPDRGLMQSLPTFIQGPKGEAGRPG
KAGPRGPPGEPGPPGPMGPPGEKGEPGRQGLPGPPGAPGLNAAGAISAATYSTVPKIAFYAGLKRQHEGY
EVLKFDDVVTNLGNHYDPTTGKFTCSIPGIYFFTYHVLMRGGDGTSMWADLCKNNQVRASAIAQDADQNY
DYASNSVVLHLEPGDEVYIKLDGGKAHGGNNNKYSTFSGFIIYAD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001010908
RefSeq Size 2493
RefSeq ORF 765
Synonyms C1ql; C1QTNF13; CTRP13; K100
Locus ID 389941
UniProt ID Q5VWW1
Cytogenetics 10p13
Summary May regulate the number of excitatory synapses that are formed on hippocampus neurons. Has no effect on inhibitory synapses (By similarity). Plays a role in glucose homeostasis. Via AMPK signaling pathway, stimulates glucose uptake in adipocytes, myotubes and hepatocytes and enhances insulin-stimulated glucose uptake. In a hepatoma cell line, reduces the expression of gluconeogenic enzymes G6PC and PCK1 and hence decreases de novo glucose production (By similarity).UniProtKB/Swiss-Prot Function
Protein Families Secreted Protein
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "C1QL3" proteins (2)
SKU Description Size Price
TP323500 Purified recombinant protein of Homo sapiens complement component 1, q subcomponent-like 3 (C1QL3), 20 µg 20 ug
$867.00
TP701110 Purified recombinant protein of Human complement component 1, q subcomponent-like 3 (C1QL3), His21-End, with C-terminal His tag, secretory expressed in HEK293 cells, 50 ug 50 ug
$900.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products