C1QL3 (NM_001010908) Human Mass Spec Standard

SKU PH323500

C1QL3 MS Standard C13 and N15-labeled recombinant protein (NP_001010908)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC223500]
• Predicted MW: 26.5 kDa
• Protein Sequence:
  Protein Sequence

  >RC223500 representing NM_001010908; Red=Cloning site Green=Tags(s); ; MVLLLVILIPVLVSSAGTSAHYEMLGTCRMVCDPYGGTKAPSTAATPDRGLMQSLPTFIQGPKGEAGRPG; KAGPRGPPGEPGPPGPMGPPGEKGEPGRQGLPGPPGAPGLNAAGAISAATYSTVPKIAFYAGLKRQHEGY; EVLKFDDVVTNLGNHYDPTTGKFTCSIPGIYFFTYHVLMRGGDGTSMWADLCKNNQVRASAIAQDADQNY; DYASNSVVLHLEPGDEVYIKLDGGKAHGGNNNKYSTFSGFIIYAD; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_001010908
• RefSeq Size: 2493
• RefSeq ORF: 765
• Synonyms: C1ql; C1QTNF13; CTRP13; K100
• Locus ID: 389941
• UniProt ID: Q5VWW1
• Cytogenetics: 10p13
• Summary: May regulate the number of excitatory synapses that are formed on hippocampus neurons. Has no effect on inhibitory synapses (By similarity). Plays a role in glucose homeostasis. Via AMPK signaling pathway, stimulates glucose uptake in adipocytes, myotubes and hepatocytes and enhances insulin-stimulated glucose uptake. In a hepatoma cell line, reduces the expression of gluconeogenic enzymes G6PC and PCK1 and hence decreases de novo glucose production (By similarity).[UniProtKB/Swiss-Prot Function]
• Protein Families: Secreted Protein