OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

MSMP (NM_001044264) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP322527
Recombinant protein of human microseminoprotein, prostate associated (MSMP), 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "MSMP or NM_001044264"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC222527 representing NM_001044264
Red=Cloning site Green=Tags(s)

MALRMLWAGQAKGILGGWGIICLVMSLLLQHPGVYSKCYFQAQAPCHYEGKYFTLGESWLRKDCFHCTCL
HPVGVGCCDTSQHPIDFPAGCEVRQEAGTCQFSLVQKSDPRLPCKGGGPDPEWGSANTPVPGAPAPHSS

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 11.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Bioactivity Cell treatment (PMID: 29059175)
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001037729
Locus ID 692094
UniProt ID Q1L6U9
Cytogenetics 9p13.3
RefSeq Size 672
RefSeq ORF 417
Synonyms PSMP
Summary This gene encodes a member of the beta-microseminoprotein family. Members of this protein family contain ten conserved cysteine residues that form intra-molecular disulfide bonds. The encoded protein may play a role in prostate cancer tumorigenesis. provided by RefSeq, Jan 2011
Protein Categories Chemokines, Cytokines, Secreated Proteins
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "MSMP" proteins (3)
SKU Description Size Price
PH322527 MSMP MS Standard C13 and N15-labeled recombinant protein (NP_001037729) 10 ug
$3,360.00
LC420820 Lyophilized MSMP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY420820 Transient overexpression lysate of microseminoprotein, prostate associated (MSMP) (as WB positive control) 100 ug
$436.00

file-alt Citations

Induction of anti-VEGF therapy resistance by upregulated expression of microseminoprotein (MSMP)
Mitamura, Pradeep, McGuire et al
Oncogene (2017)
Cited by 52
AI Summary: OriGene contributed to this study by providing the recombinant MSMP (rMSMP) protein, which was used to investigate the role of MSMP in mediating resistance to anti-VEGF therapy.
Snippet: Briefly, 40 nM siRNA was mixed with RNAiMAX and added to culture medium for 6-12 h. We added fresh medium to the mixture, and cells were allowed to grow in it. We purchased rMSMP protein from OriGene (Rockville, MD, USA)
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products