OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

MSMP (NM_001044264) Human Mass Spec Standard

Be the first to review this product
SKU
PH322527
MSMP MS Standard C13 and N15-labeled recombinant protein (NP_001037729)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY420820 Transient overexpression lysate of microseminoprotein, prostate associated (MSMP) (as WB positive control) 100 ug
$436.00

Other products for "MSMP or NM_001044264"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC222527
Predicted MW 14.99 kDa
Protein Sequence
Protein Sequence
>RC222527 representing NM_001044264
Red=Cloning site Green=Tags(s)

MALRMLWAGQAKGILGGWGIICLVMSLLLQHPGVYSKCYFQAQAPCHYEGKYFTLGESWLRKDCFHCTCL
HPVGVGCCDTSQHPIDFPAGCEVRQEAGTCQFSLVQKSDPRLPCKGGGPDPEWGSANTPVPGAPAPHSS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001037729
RefSeq Size 672
RefSeq ORF 417
Synonyms PSMP
Locus ID 692094
UniProt ID Q1L6U9
Cytogenetics 9p13.3
Summary This gene encodes a member of the beta-microseminoprotein family. Members of this protein family contain ten conserved cysteine residues that form intra-molecular disulfide bonds. The encoded protein may play a role in prostate cancer tumorigenesis. provided by RefSeq, Jan 2011
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "MSMP" proteins (3)
SKU Description Size Price
LC420820 Lyophilized MSMP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY420820 Transient overexpression lysate of microseminoprotein, prostate associated (MSMP) (as WB positive control) 100 ug
$436.00
TP322527 Recombinant protein of human microseminoprotein, prostate associated (MSMP), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products