CCDC140 (NM_153038) Human Recombinant Protein

CAT#: TP322414

Recombinant protein of human coiled-coil domain containing 140 (CCDC140), 20 µg

Product Images

Coomassie blue staining of purified CCDC140 protein (Cat# TP322414). The protein was produced from HEK293T cells transfected with CCDC140 cDNA clone (Cat# RC222414) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC222414 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGDECSNPDLLAEPGSSPPWDHGNQRQEAANESNTRVPRVLKAHLGPETAQPTKRSKRNRWRRQSCQGPS
  PARSGQFLGSADLGLQRGVLKSAARTCLSEISNSTRASPESAQSTDPGRAARPRTRTLPTPHSFKIGEEA
  EEMKKKKERKRRKERKKERNFKK
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 18.1 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_694583
• Locus ID: 151278
• UniProt ID: Q96MF4
• Cytogenetics: 2q36.1
• Refseq Size: 1699
• Refseq ORF: 489
• Synonyms: FLJ32447; MGC133159
• Summary: This gene encodes a protein that appears to be restricted to select higher primate species. This protein contains a C-terminal coiled-coil domain, which is a versatile structural motif consisting of multiple amphipathic alpha-helices that twist around each other to form a supercoil. [provided by RefSeq, Aug 2011]