OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CCDC140 (NM_153038) Human Mass Spec Standard

Be the first to review this product
SKU
PH322414
CCDC140 MS Standard C13 and N15-labeled recombinant protein (NP_694583)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY407174 Transient overexpression lysate of coiled-coil domain containing 140 (CCDC140) (as WB positive control) 100 ug
$436.00

Other products for "CCDC140 or NM_153038"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC222414
Predicted MW 18.3 kDa
Protein Sequence
Protein Sequence
>RC222414 protein sequence
Red=Cloning site Green=Tags(s)

MGDECSNPDLLAEPGSSPPWDHGNQRQEAANESNTRVPRVLKAHLGPETAQPTKRSKRNRWRRQSCQGPS
PARSGQFLGSADLGLQRGVLKSAARTCLSEISNSTRASPESAQSTDPGRAARPRTRTLPTPHSFKIGEEA
EEMKKKKERKRRKERKKERNFKK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_694583
RefSeq Size 1699
RefSeq ORF 489
Synonyms FLJ32447; MGC133159
Locus ID 151278
UniProt ID Q96MF4
Cytogenetics 2q36.1
Summary This gene encodes a protein that appears to be restricted to select higher primate species. This protein contains a C-terminal coiled-coil domain, which is a versatile structural motif consisting of multiple amphipathic alpha-helices that twist around each other to form a supercoil. provided by RefSeq, Aug 2011
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CCDC140" proteins (3)
SKU Description Size Price
LC407174 Lyophilized CCDC140 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY407174 Transient overexpression lysate of coiled-coil domain containing 140 (CCDC140) (as WB positive control) 100 ug
$436.00
TP322414 Recombinant protein of human coiled-coil domain containing 140 (CCDC140), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products