CHKL (CHKB) (NM_152253) Human Recombinant Protein

CAT#: TP322406

Recombinant protein of human choline kinase beta (CHKB), transcript variant 2, 20 µg

Product Images

Coomassie blue staining of purified CHKB protein (Cat# TP322406). The protein was produced from HEK293T cells transfected with CHKB cDNA clone (Cat# RC222406) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC222406 representing NM_152253
  Red=Cloning site Green=Tags(s)
  
  MAAEATAVAGSGAVGGCLAKDGLQQSKCPDTTPKRRRASSLSRDAERRAYQWCREYLGGAWRRVQPEELR
  VYPVRWEVRGQPLRCADRGQGSAAGPSGCSMFSPPSCARAWGGAGPAWPGGGRGRGR
  
  TRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Tag: C-Myc/DDK
• Predicted MW: 13.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_689466
• Locus ID: 1120
• UniProt ID: Q9Y259
• Cytogenetics: 22q13.33
• Refseq Size: 4914
• Refseq ORF: 381
• Synonyms: CHETK; CHKL; choline/ethanolamine kinase; choline kinase-like; choline kinase beta; CKEKB; EKB
• Summary: Choline kinase (CK) and ethanolamine kinase (EK) catalyze the phosphorylation of choline/ethanolamine to phosphocholine/phosphoethanolamine. This is the first enzyme in the biosynthesis of phosphatidylcholine/phosphatidylethanolamine in all animal cells. The highly purified CKs from mammalian sources and their recombinant gene products have been shown to have EK activity also, indicating that both activities reside on the same protein. The choline kinase-like protein encoded by CHKL belongs to the choline/ethanolamine kinase family; however, its exact function is not known. Read-through transcripts are expressed from this locus that include exons from the downstream CPT1B locus. [provided by RefSeq, Jun 2009]
• Protein Families: Druggable Genome
• Protein Pathways: Glycerophospholipid metabolism, Metabolic pathways