CHKL (CHKB) (NM_152253) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC222406] |
Predicted MW | 13.3 kDa |
Protein Sequence |
Protein Sequence
>RC222406 representing NM_152253
Red=Cloning site Green=Tags(s) MAAEATAVAGSGAVGGCLAKDGLQQSKCPDTTPKRRRASSLSRDAERRAYQWCREYLGGAWRRVQPEELR VYPVRWEVRGQPLRCADRGQGSAAGPSGCSMFSPPSCARAWGGAGPAWPGGGRGRGR myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_689466 |
RefSeq Size | 4914 |
RefSeq ORF | 381 |
Synonyms | CHETK; CHKL; choline/ethanolamine kinase; choline kinase-like; choline kinase beta; CKEKB; EKB |
Locus ID | 1120 |
UniProt ID | Q9Y259 |
Cytogenetics | 22q13.33 |
Summary | Choline kinase (CK) and ethanolamine kinase (EK) catalyze the phosphorylation of choline/ethanolamine to phosphocholine/phosphoethanolamine. This is the first enzyme in the biosynthesis of phosphatidylcholine/phosphatidylethanolamine in all animal cells. The highly purified CKs from mammalian sources and their recombinant gene products have been shown to have EK activity also, indicating that both activities reside on the same protein. The choline kinase-like protein encoded by CHKL belongs to the choline/ethanolamine kinase family; however, its exact function is not known. Read-through transcripts are expressed from this locus that include exons from the downstream CPT1B locus. [provided by RefSeq, Jun 2009] |
Protein Families | Druggable Genome |
Protein Pathways | Glycerophospholipid metabolism, Metabolic pathways |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH310253 | CHKB MS Standard C13 and N15-labeled recombinant protein (NP_005189) | 10 ug |
$3,255.00
|
|
LC407681 | CHKB HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC417454 | CHKB HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC429244 | CHKB HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY407681 | Transient overexpression lysate of choline kinase beta (CHKB), transcript variant 2 | 100 ug |
$436.00
|
|
LY417454 | Transient overexpression lysate of choline kinase beta (CHKB) | 100 ug |
$436.00
|
|
LY429244 | Transient overexpression lysate of choline kinase beta (CHKB) | 100 ug |
$436.00
|
|
TP310253 | Recombinant protein of human choline kinase beta (CHKB), transcript variant 1, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP322406 | Recombinant protein of human choline kinase beta (CHKB), transcript variant 2, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.