CHKL (CHKB) (NM_005198) Human Recombinant Protein

SKU
TP310253
Recombinant protein of human choline kinase beta (CHKB), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC210253 representing NM_005198
Red=Cloning site Green=Tags(s)

MAAEATAVAGSGAVGGCLAKDGLQQSKCPDTTPKRRRASSLSRDAERRAYQWCREYLGGAWRRVQPEELR
VYPVSGGLSNLLFRCSLPDHLPSVGEEPREVLLRLYGAILQGVDSLVLESVMFAILAERSLGPQLYGVFP
EGRLEQYIPSRPLKTQELREPVLSAAIATKMAQFHGMEMPFTKEPHWLFGTMERYLKQIQDLPPTGLPEM
NLLEMYSLKDEMGNLRKLLESTPSPVVFCHNDIQEGNILLLSEPENADSLMLVDFEYSSYNYRGFDIGNH
FCEWVYDYTHEEWPFYKARPTDYPTQEQQLHFIRHYLAEAKKGETLSQEEQRKLEEDLLVEVSRYALASH
FFWGLWSILQASMSTIEFGYLDYAQSRFQFYFQQKGQLTSVHSSS

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 45.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_005189
Locus ID 1120
UniProt ID Q9Y259
Cytogenetics 22q13.33
RefSeq Size 1595
RefSeq ORF 1185
Synonyms CHETK; CHKL; CK; CKB; CKEKB; EK; EKB; MDCMC
Summary Choline kinase (CK) and ethanolamine kinase (EK) catalyze the phosphorylation of choline/ethanolamine to phosphocholine/phosphoethanolamine. This is the first enzyme in the biosynthesis of phosphatidylcholine/phosphatidylethanolamine in all animal cells. The highly purified CKs from mammalian sources and their recombinant gene products have been shown to have EK activity also, indicating that both activities reside on the same protein. The choline kinase-like protein encoded by CHKL belongs to the choline/ethanolamine kinase family; however, its exact function is not known. Read-through transcripts are expressed from this locus that include exons from the downstream CPT1B locus. [provided by RefSeq, Jun 2009]
Protein Families Druggable Genome
Protein Pathways Glycerophospholipid metabolism, Metabolic pathways
Write Your Own Review
You're reviewing:CHKL (CHKB) (NM_005198) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH310253 CHKB MS Standard C13 and N15-labeled recombinant protein (NP_005189) 10 ug
$3,255.00
PH322406 CHKB MS Standard C13 and N15-labeled recombinant protein (NP_689466) 10 ug
$3,255.00
LC407681 CHKB HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC417454 CHKB HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC429244 CHKB HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY407681 Transient overexpression lysate of choline kinase beta (CHKB), transcript variant 2 100 ug
$436.00
LY417454 Transient overexpression lysate of choline kinase beta (CHKB) 100 ug
$436.00
LY429244 Transient overexpression lysate of choline kinase beta (CHKB) 100 ug
$436.00
TP322406 Recombinant protein of human choline kinase beta (CHKB), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.