CHKL (CHKB) (NM_152253) Human Tagged ORF Clone
SKU
RC222406
CHKB (Myc-DDK-tagged)-Human choline kinase beta (CHKB), transcript variant 2
-
TrueORF®
TrueORF®
Expression-ready ORF plasmid with C-terminal tag(s)
Click here to learn more.
Product Data | |
Type | Human Tagged ORF Clone |
---|---|
Target Symbol | CHKL |
Synonyms | CHETK; CHKL; choline/ethanolamine kinase; choline kinase-like; choline kinase beta; CKEKB; EKB |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
ORF Nucleotide Sequence
>RC222406 representing NM_152253
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCGGCCGAGGCGACAGCTGTGGCCGGAAGCGGGGCTGTTGGCGGCTGCCTGGCCAAAGACGGCTTGC AGCAGTCTAAGTGCCCGGACACTACCCCAAAACGGCGGCGCGCCTCGTCGCTGTCGCGTGACGCCGAGCG CCGAGCCTACCAATGGTGCCGGGAGTACTTGGGCGGGGCCTGGCGCCGAGTGCAGCCCGAGGAGCTGAGG GTTTACCCCGTGAGGTGGGAGGTCAGGGGTCAGCCTCTCCGGTGCGCGGATCGGGGTCAGGGGTCAGCCG CGGGGCCCTCAGGATGCTCCATGTTTTCGCCCCCCTCTTGCGCCCGCGCCTGGGGCGGGGCGGGGCCGGC CTGGCCGGGAGGGGGCCGGGGCCGCGGCAGG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC222406 representing NM_152253
Red=Cloning site Green=Tags(s) MAAEATAVAGSGAVGGCLAKDGLQQSKCPDTTPKRRRASSLSRDAERRAYQWCREYLGGAWRRVQPEELR VYPVRWEVRGQPLRCADRGQGSAAGPSGCSMFSPPSCARAWGGAGPAWPGGGRGRGR myc-FLAG tag |
Restriction Sites |
SgfI-MluI Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_152253 |
ORF Size | 381 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution Method | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Shipping | Ambient |
Reference Data | |
RefSeq | NM_152253.1, NP_689466.1 |
RefSeq Size | 4914 bp |
RefSeq ORF | 383 bp |
Locus ID | 1120 |
Cytogenetics | 22q13.33 |
Domains | Carn_acyltransf |
Protein Families | Druggable Genome |
Protein Pathways | Glycerophospholipid metabolism, Metabolic pathways |
MW | 13.3 kDa |
Summary | Choline kinase (CK) and ethanolamine kinase (EK) catalyze the phosphorylation of choline/ethanolamine to phosphocholine/phosphoethanolamine. This is the first enzyme in the biosynthesis of phosphatidylcholine/phosphatidylethanolamine in all animal cells. The highly purified CKs from mammalian sources and their recombinant gene products have been shown to have EK activity also, indicating that both activities reside on the same protein. The choline kinase-like protein encoded by CHKL belongs to the choline/ethanolamine kinase family; however, its exact function is not known. Read-through transcripts are expressed from this locus that include exons from the downstream CPT1B locus. [provided by RefSeq, Jun 2009] |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
SKU | Description | Size | Price | |
---|---|---|---|---|
RC222406L3 | Lenti-ORF clone of CHKB (Myc-DDK-tagged)-Human choline kinase beta (CHKB), transcript variant 2 | 10 ug |
$450.00
|
|
RC222406L4 | Lenti-ORF clone of CHKB (mGFP-tagged)-Human choline kinase beta (CHKB), transcript variant 2 | 10 ug |
$450.00
|
|
RG222406 | CHKB (tGFP-tagged) - Human choline kinase beta (CHKB), transcript variant 2 | 10 ug |
$489.00
|
|
SC109066 | CHKB (untagged)-Human choline kinase beta (CHKB), transcript variant 2 | 10 ug |
$150.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.