CHKL (CHKB) (NM_152253) Human Tagged ORF Clone

SKU
RC222406
CHKB (Myc-DDK-tagged)-Human choline kinase beta (CHKB), transcript variant 2
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00
2 Weeks*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CHKL
Synonyms CHETK; CHKL; choline/ethanolamine kinase; choline kinase-like; choline kinase beta; CKEKB; EKB
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC222406 representing NM_152253
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGCCGAGGCGACAGCTGTGGCCGGAAGCGGGGCTGTTGGCGGCTGCCTGGCCAAAGACGGCTTGC
AGCAGTCTAAGTGCCCGGACACTACCCCAAAACGGCGGCGCGCCTCGTCGCTGTCGCGTGACGCCGAGCG
CCGAGCCTACCAATGGTGCCGGGAGTACTTGGGCGGGGCCTGGCGCCGAGTGCAGCCCGAGGAGCTGAGG
GTTTACCCCGTGAGGTGGGAGGTCAGGGGTCAGCCTCTCCGGTGCGCGGATCGGGGTCAGGGGTCAGCCG
CGGGGCCCTCAGGATGCTCCATGTTTTCGCCCCCCTCTTGCGCCCGCGCCTGGGGCGGGGCGGGGCCGGC
CTGGCCGGGAGGGGGCCGGGGCCGCGGCAGG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC222406 representing NM_152253
Red=Cloning site Green=Tags(s)

MAAEATAVAGSGAVGGCLAKDGLQQSKCPDTTPKRRRASSLSRDAERRAYQWCREYLGGAWRRVQPEELR
VYPVRWEVRGQPLRCADRGQGSAAGPSGCSMFSPPSCARAWGGAGPAWPGGGRGRGR

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_152253
ORF Size 381 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_152253.1, NP_689466.1
RefSeq Size 4914 bp
RefSeq ORF 383 bp
Locus ID 1120
Cytogenetics 22q13.33
Domains Carn_acyltransf
Protein Families Druggable Genome
Protein Pathways Glycerophospholipid metabolism, Metabolic pathways
MW 13.3 kDa
Summary Choline kinase (CK) and ethanolamine kinase (EK) catalyze the phosphorylation of choline/ethanolamine to phosphocholine/phosphoethanolamine. This is the first enzyme in the biosynthesis of phosphatidylcholine/phosphatidylethanolamine in all animal cells. The highly purified CKs from mammalian sources and their recombinant gene products have been shown to have EK activity also, indicating that both activities reside on the same protein. The choline kinase-like protein encoded by CHKL belongs to the choline/ethanolamine kinase family; however, its exact function is not known. Read-through transcripts are expressed from this locus that include exons from the downstream CPT1B locus. [provided by RefSeq, Jun 2009]
Write Your Own Review
You're reviewing:CHKL (CHKB) (NM_152253) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC222406L3 Lenti-ORF clone of CHKB (Myc-DDK-tagged)-Human choline kinase beta (CHKB), transcript variant 2 10 ug
$450.00
RC222406L4 Lenti-ORF clone of CHKB (mGFP-tagged)-Human choline kinase beta (CHKB), transcript variant 2 10 ug
$450.00
RG222406 CHKB (tGFP-tagged) - Human choline kinase beta (CHKB), transcript variant 2 10 ug
$489.00
SC109066 CHKB (untagged)-Human choline kinase beta (CHKB), transcript variant 2 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.