OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DGKA (NM_001345) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP322395
Purified recombinant protein of Homo sapiens diacylglycerol kinase, alpha 80kDa (DGKA), transcript variant 3, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA504024 DGKA mouse monoclonal antibody, clone OTI3G7 (formerly 3G7) 100 ul
$447.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "DGKA or NM_001345"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC222395 representing NM_001345
Red=Cloning site Green=Tags(s)

MAKERGLISPSDFAQLQKYMEYSTKKVSDVLKLFEDGEMAKYVQGDAIGYEGFQQFLKIYLEVDNVPRHL
SLALFQSFETGHCLNETNVTKDVVCLNDVSCYFSLLEGGRPEDKLEFTFKLYDTDRNGILDSSEVDKIIL
QMMRVAEYLDWDVSELRPILQEMMKEIDYDGSGSVSQAEWVRAGATTVPLLVLLGLEMTLKDDGQHMWRP
KRFPRPVYCNLCESSIGLGKQGLSCNLCKYTVHDQCAMKALPCEVSTYAKSRKDIGVQSHVWVRGGCESG
RCDRCQKKIRIYHSLTGLHCVWCHLEIHDDCLQAVGHECDCGLLRDHILPPSSIYPSVLASGPDRKNSKT
SQKTMDDLNLSTSEALRIDPVPNTHPLLVFVNPKSGGKQGQRVLWKFQYILNPRQVFNLLKDGPEIGLRL
FKDVPDSRILVCGGDGTVGWILETIDKANLPVLPPVAVLPLGTGNDLARCLRWGGGYEGQNLAKILKDLE
MSKVVHMDRWSVEVIPQQTEEKSDPVPFQIINNYFSIGVDASIAHRFHIMREKYPEKFNSRMKNKLWYFE
FATSESIFSTCKKLEESLTVEICGKPLDLSNLSLEGIAVLNIPSMHGGSNLWGDTRRPHGDIYGINQALG
ATAKVITDPDILKTCVPDLSDKRLEVVGLEGAIEMGQIYTKLKNAGRRLAKCSEITFHTTKTLPMQIDGE
PWMQTPCTIKITHKNQMPMLMGPPPRSTNFFGFLS

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 82.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001336
Locus ID 1606
UniProt ID P23743
Cytogenetics 12q13.2
RefSeq Size 2756
RefSeq ORF 2205
Synonyms DAGK; DAGK1; DGK-alpha
Summary The protein encoded by this gene belongs to the eukaryotic diacylglycerol kinase family. It acts as a modulator that competes with protein kinase C for the second messenger diacylglycerol in intracellular signaling pathways. It also plays an important role in the resynthesis of phosphatidylinositols and phosphorylating diacylglycerol to phosphatidic acid. Several transcript variants encoding different isoforms have been identified for this gene. provided by RefSeq, Apr 2017
Protein Categories Intracellular Proteins
Protein Families Druggable Genome
Protein Pathways Glycerolipid metabolism, Glycerophospholipid metabolism, Metabolic pathways, Phosphatidylinositol signaling system
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "DGKA" proteins (17)
SKU Description Size Price
PH302930 DGKA MS Standard C13 and N15-labeled recombinant protein (NP_958852) 10 ug
$3,360.00
PH318968 DGKA MS Standard C13 and N15-labeled recombinant protein (NP_958853) 10 ug
$3,360.00
PH320293 DGKA MS Standard C13 and N15-labeled recombinant protein (NP_963848) 10 ug
$3,360.00
PH322395 DGKA MS Standard C13 and N15-labeled recombinant protein (NP_001336) 10 ug
$3,360.00
LC400535 Lyophilized DGKA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC404426 Lyophilized DGKA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC404427 Lyophilized DGKA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC404458 Lyophilized DGKA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC430856 Lyophilized DGKA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400535 Transient overexpression lysate of diacylglycerol kinase, alpha 80kDa (DGKA), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY404426 Transient overexpression lysate of diacylglycerol kinase, alpha 80kDa (DGKA), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY404427 Transient overexpression lysate of diacylglycerol kinase, alpha 80kDa (DGKA), transcript variant 2 (as WB positive control) 100 ug
$665.00
LY404458 Transient overexpression lysate of diacylglycerol kinase, alpha 80kDa (DGKA), transcript variant 4 (as WB positive control) 100 ug
$436.00
LY430856 Transient overexpression lysate of diacylglycerol kinase, alpha 80kDa (DGKA), transcript variant 1 (as WB positive control) 100 ug
$665.00
TP302930 Recombinant protein of human diacylglycerol kinase, alpha 80kDa (DGKA), transcript variant 1, 20 µg 20 ug
$867.00
TP318968 Recombinant protein of human diacylglycerol kinase, alpha 80kDa (DGKA), transcript variant 2, 20 µg 20 ug
$867.00
TP320293 Recombinant protein of human diacylglycerol kinase, alpha 80kDa (DGKA), transcript variant 4, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products