DGKA (NM_201554) Human Mass Spec Standard

SKU
PH320293
DGKA MS Standard C13 and N15-labeled recombinant protein (NP_963848)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC220293]
Predicted MW 82.6 kDa
Protein Sequence
Protein Sequence
>RC220293 protein sequence
Red=Cloning site Green=Tags(s)

MAKERGLISPSDFAQLQKYMEYSTKKVSDVLKLFEDGEMAKYVQGDAIGYEGFQQFLKIYLEVDNVPRHL
SLALFQSFETGHCLNETNVTKDVVCLNDVSCYFSLLEGGRPEDKLEFTFKLYDTDRNGILDSSEVDKIIL
QMMRVAEYLDWDVSELRPILQEMMKEIDYDGSGSVSQAEWVRAGATTVPLLVLLGLEMTLKDDGQHMWRP
KRFPRPVYCNLCESSIGLGKQGLSCNLCKYTVHDQCAMKALPCEVSTYAKSRKDIGVQSHVWVRGGCESG
RCDRCQKKIRIYHSLTGLHCVWCHLEIHDDCLQAVGHECDCGLLRDHILPPSSIYPSVLASGPDRKNSKT
SQKTMDDLNLSTSEALRIDPVPNTHPLLVFVNPKSGGKQGQRVLWKFQYILNPRQVFNLLKDGPEIGLRL
FKDVPDSRILVCGGDGTVGWILETIDKANLPVLPPVAVLPLGTGNDLARCLRWGGGYEGQNLAKILKDLE
MSKVVHMDRWSVEVIPQQTEEKSDPVPFQIINNYFSIGVDASIAHRFHIMREKYPEKFNSRMKNKLWYFE
FATSESIFSTCKKLEESLTVEICGKPLDLSNLSLEGIAVLNIPSMHGGSNLWGDTRRPHGDIYGINQALG
ATAKVITDPDILKTCVPDLSDKRLEVVGLEGAIEMGQIYTKLKNAGRRLAKCSEITFHTTKTLPMQIDGE
PWMQTPCTIKITHKNQMPMLMGPPPRSTNFFGFLS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_963848
RefSeq Size 2669
RefSeq ORF 2205
Synonyms DAGK; DAGK1; DGK-alpha
Locus ID 1606
UniProt ID P23743
Cytogenetics 12q13.2
Summary The protein encoded by this gene belongs to the eukaryotic diacylglycerol kinase family. It acts as a modulator that competes with protein kinase C for the second messenger diacylglycerol in intracellular signaling pathways. It also plays an important role in the resynthesis of phosphatidylinositols and phosphorylating diacylglycerol to phosphatidic acid. Several transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq, Apr 2017]
Protein Families Druggable Genome
Protein Pathways Glycerolipid metabolism, Glycerophospholipid metabolism, Metabolic pathways, Phosphatidylinositol signaling system
Write Your Own Review
You're reviewing:DGKA (NM_201554) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH302930 DGKA MS Standard C13 and N15-labeled recombinant protein (NP_958852) 10 ug
$3,255.00
PH318968 DGKA MS Standard C13 and N15-labeled recombinant protein (NP_958853) 10 ug
$3,255.00
PH322395 DGKA MS Standard C13 and N15-labeled recombinant protein (NP_001336) 10 ug
$3,255.00
LC400535 DGKA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC404426 DGKA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC404427 DGKA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC404458 DGKA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC430856 DGKA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400535 Transient overexpression lysate of diacylglycerol kinase, alpha 80kDa (DGKA), transcript variant 3 100 ug
$436.00
LY404426 Transient overexpression lysate of diacylglycerol kinase, alpha 80kDa (DGKA), transcript variant 1 100 ug
$436.00
LY404427 Transient overexpression lysate of diacylglycerol kinase, alpha 80kDa (DGKA), transcript variant 2 100 ug
$665.00
LY404458 Transient overexpression lysate of diacylglycerol kinase, alpha 80kDa (DGKA), transcript variant 4 100 ug
$436.00
LY430856 Transient overexpression lysate of diacylglycerol kinase, alpha 80kDa (DGKA), transcript variant 1 100 ug
$665.00
TP302930 Recombinant protein of human diacylglycerol kinase, alpha 80kDa (DGKA), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP318968 Recombinant protein of human diacylglycerol kinase, alpha 80kDa (DGKA), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP320293 Recombinant protein of human diacylglycerol kinase, alpha 80kDa (DGKA), transcript variant 4, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP322395 Purified recombinant protein of Homo sapiens diacylglycerol kinase, alpha 80kDa (DGKA), transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.