OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DGKA (NM_201444) Human Mass Spec Standard

Be the first to review this product
SKU
PH302930
DGKA MS Standard C13 and N15-labeled recombinant protein (NP_958852)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA504024 DGKA mouse monoclonal antibody, clone OTI3G7 (formerly 3G7) 100 ul
$447.00
LY430856 Transient overexpression lysate of diacylglycerol kinase, alpha 80kDa (DGKA), transcript variant 1 (as WB positive control) 100 ug
$665.00

Other products for "DGKA or NM_201444"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC202930
Predicted MW 82.6 kDa
Protein Sequence
Protein Sequence
>RC202930 protein sequence
Red=Cloning site Green=Tags(s)

MAKERGLISPSDFAQLQKYMEYSTKKVSDVLKLFEDGEMAKYVQGDAIGYEGFQQFLKIYLEVDNVPRHL
SLALFQSFETGHCLNETNVTKDVVCLNDVSCYFSLLEGGRPEDKLEFTFKLYDTDRNGILDSSEVDKIIL
QMMRVAEYLDWDVSELRPILQEMMKEIDYDGSGSVSQAEWVRAGATTVPLLVLLGLEMTLKDDGQHMWRP
KRFPRPVYCNLCESSIGLGKQGLSCNLCKYTVHDQCAMKALPCEVSTYAKSRKDIGVQSHVWVRGGCESG
RCDRCQKKIRIYHSLTGLHCVWCHLEIHDDCLQAVGHECDCGLLRDHILPPSSIYPSVLASGPDRKNSKT
SQKTMDDLNLSTSEALRIDPVPNTHPLLVFVNPKSGGKQGQRVLWKFQYILNPRQVFNLLKDGPEIGLRL
FKDVPDSRILVCGGDGTVGWILETIDKANLPVLPPVAVLPLGTGNDLARCLRWGGGYEGQNLAKILKDLE
MSKVVHMDRWSVEVIPQQTEEKSDPVPFQIINNYFSIGVDASIAHRFHIMREKYPEKFNSRMKNKLWYFE
FATSESIFSTCKKLEESLTVEICGKPLDLSNLSLEGIAVLNIPSMHGGSNLWGDTRRPHGDIYGINQALG
ATAKVITDPDILKTCVPDLSDKRLEVVGLEGAIEMGQIYTKLKNAGRRLAKCSEITFHTTKTLPMQIDGE
PWMQTPCTIKITHKNQMPMLMGPPPRSTNFFGFLS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_958852
RefSeq Size 2801
RefSeq ORF 2205
Synonyms DAGK; DAGK1; DGK-alpha
Locus ID 1606
UniProt ID P23743
Cytogenetics 12q13.2
Summary The protein encoded by this gene belongs to the eukaryotic diacylglycerol kinase family. It acts as a modulator that competes with protein kinase C for the second messenger diacylglycerol in intracellular signaling pathways. It also plays an important role in the resynthesis of phosphatidylinositols and phosphorylating diacylglycerol to phosphatidic acid. Several transcript variants encoding different isoforms have been identified for this gene. provided by RefSeq, Apr 2017
Protein Families Druggable Genome
Protein Pathways Glycerolipid metabolism, Glycerophospholipid metabolism, Metabolic pathways, Phosphatidylinositol signaling system
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "DGKA" proteins (17)
SKU Description Size Price
PH318968 DGKA MS Standard C13 and N15-labeled recombinant protein (NP_958853) 10 ug
$3,360.00
PH320293 DGKA MS Standard C13 and N15-labeled recombinant protein (NP_963848) 10 ug
$3,360.00
PH322395 DGKA MS Standard C13 and N15-labeled recombinant protein (NP_001336) 10 ug
$3,360.00
LC400535 Lyophilized DGKA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC404426 Lyophilized DGKA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC404427 Lyophilized DGKA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC404458 Lyophilized DGKA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC430856 Lyophilized DGKA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400535 Transient overexpression lysate of diacylglycerol kinase, alpha 80kDa (DGKA), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY404426 Transient overexpression lysate of diacylglycerol kinase, alpha 80kDa (DGKA), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY404427 Transient overexpression lysate of diacylglycerol kinase, alpha 80kDa (DGKA), transcript variant 2 (as WB positive control) 100 ug
$665.00
LY404458 Transient overexpression lysate of diacylglycerol kinase, alpha 80kDa (DGKA), transcript variant 4 (as WB positive control) 100 ug
$436.00
LY430856 Transient overexpression lysate of diacylglycerol kinase, alpha 80kDa (DGKA), transcript variant 1 (as WB positive control) 100 ug
$665.00
TP302930 Recombinant protein of human diacylglycerol kinase, alpha 80kDa (DGKA), transcript variant 1, 20 µg 20 ug
$867.00
TP318968 Recombinant protein of human diacylglycerol kinase, alpha 80kDa (DGKA), transcript variant 2, 20 µg 20 ug
$867.00
TP320293 Recombinant protein of human diacylglycerol kinase, alpha 80kDa (DGKA), transcript variant 4, 20 µg 20 ug
$867.00
TP322395 Purified recombinant protein of Homo sapiens diacylglycerol kinase, alpha 80kDa (DGKA), transcript variant 3, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products