NICE2 (S100A7A) (NM_176823) Human Recombinant Protein

SKU TP321177L

Recombinant protein of human S100 calcium binding protein A7A (S100A7A), 1 mg

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC221177 representing NM_176823; Red=Cloning site Green=Tags(s); ; MSNTQAERSIIGMIDMFHKYTGRDGKIEKPSLLTMMKENFPNFLSACDKKGIHYLATVFEKKDKNEDKKI; DFSEFLSLLGDIAADYHKQSHGAAPCSGGSQ; ; myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 11.1 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_789793
• Locus ID: 338324
• UniProt ID: Q86SG5
• Cytogenetics: 1q21.3
• RefSeq Size: 4351
• RefSeq ORF: 303
• Synonyms: NICE-2; NICE2; S100A7f; S100A7L1; S100A15
• Summary: May be involved in epidermal differentiation and inflammation and might therefore be important for the pathogenesis of psoriasis and other diseases.[UniProtKB/Swiss-Prot Function]