OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

NICE2 (S100A7A) (NM_176823) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP321177L
Recombinant protein of human S100 calcium binding protein A7A (S100A7A), 1 mg
Size:
1 mg 20 ug 100 ug
  $9,200.00
6 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA337753 Rabbit Polyclonal Anti-S100A7A Antibody
100 ul
$585.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "NICE2 or NM_176823"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC221177 representing NM_176823
Red=Cloning site Green=Tags(s)

MSNTQAERSIIGMIDMFHKYTGRDGKIEKPSLLTMMKENFPNFLSACDKKGIHYLATVFEKKDKNEDKKI
DFSEFLSLLGDIAADYHKQSHGAAPCSGGSQ

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 11.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_789793
Locus ID 338324
UniProt ID Q86SG5
Cytogenetics 1q21.3
RefSeq Size 4351
RefSeq ORF 303
Synonyms NICE-2; NICE2; S100A7f; S100A7L1; S100A15
Summary May be involved in epidermal differentiation and inflammation and might therefore be important for the pathogenesis of psoriasis and other diseases.UniProtKB/Swiss-Prot Function
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products