NICE2 (S100A7A) Rabbit Polyclonal Antibody

SKU TA337753

Rabbit Polyclonal Anti-S100A7A Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-S100A7A antibody is: synthetic peptide directed towards the middle region of Human S100A7A. Synthetic peptide located within the following region: CDKKGIHYLATVFEKKDKNEDKKIDFSEFLSLLGDIAADYHKQSHGAAPC
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 11 kDa
• Gene Name: S100 calcium binding protein A7A
• Database Link:
  NP_789793
  Q86SG5
• Background: S100A7A may be involved in epidermal differentiation and inflammation and might therefore be important for the pathogenesis of psoriasis and other diseases.
• Synonyms: NICE-2; S100A7f; S100A7L1; S100A15
• Note: Immunogen Sequence Homology: Human: 100%; Horse: 93%; Bovine: 93%; Goat: 86%

Reference Data